BLASTX nr result
ID: Zingiber23_contig00052800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052800 (253 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADO00336.1| F-box protein [Elaeis guineensis] 62 8e-08 >gb|ADO00336.1| F-box protein [Elaeis guineensis] Length = 178 Score = 62.0 bits (149), Expect = 8e-08 Identities = 36/66 (54%), Positives = 44/66 (66%), Gaps = 2/66 (3%) Frame = -1 Query: 253 KFVRSTSTLGRKRVVLSKSADFSPHCGSSSSP--KKLCRRSTMERSNHLEALPLDVLVKI 80 KFV + LGRKRVV+S S D S S P K+ RS +ERSN LE+LP DVLV+I Sbjct: 17 KFVPGSCILGRKRVVISDSLDSSNSSSPLSGPLQKRRGARSFVERSNCLESLPQDVLVRI 76 Query: 79 LCRVDH 62 LC+V+H Sbjct: 77 LCKVNH 82