BLASTX nr result
ID: Zingiber23_contig00052758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052758 (474 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298550.2| hypothetical protein POPTR_0001s35490g [Popu... 65 7e-09 gb|EOY02531.1| NAC domain transcriptional regulator superfamily ... 65 1e-08 ref|XP_002272446.1| PREDICTED: NAC domain-containing protein 8 [... 65 1e-08 gb|EMJ16704.1| hypothetical protein PRUPE_ppa006948mg [Prunus pe... 62 1e-07 ref|XP_004156732.1| PREDICTED: NAC domain-containing protein 8-l... 62 1e-07 ref|XP_004142846.1| PREDICTED: NAC domain-containing protein 8-l... 62 1e-07 gb|AHJ79160.1| NAC domain protein NAC19 [Gossypium hirsutum] 60 2e-07 ref|XP_002521482.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 ref|XP_004231842.1| PREDICTED: NAC domain-containing protein 8-l... 60 4e-07 gb|EXC20358.1| NAC domain-containing protein 8 [Morus notabilis] 59 7e-07 ref|XP_006338624.1| PREDICTED: NAC domain-containing protein 8-l... 58 1e-06 gb|AGL39749.1| NAC transcription factor 093 [Jatropha curcas] 57 2e-06 ref|XP_006852355.1| hypothetical protein AMTR_s00049p00217900 [A... 57 3e-06 >ref|XP_002298550.2| hypothetical protein POPTR_0001s35490g [Populus trichocarpa] gi|550348950|gb|EEE83355.2| hypothetical protein POPTR_0001s35490g [Populus trichocarpa] Length = 395 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = +3 Query: 15 VAGTSGLACGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 V G + CGIA+L+++ +DTPPDFQL++LQFGSQESI+ WLDR Sbjct: 351 VNGNNNEPCGIAELENLELDTPPDFQLADLQFGSQESILGWLDR 394 >gb|EOY02531.1| NAC domain transcriptional regulator superfamily protein, putative [Theobroma cacao] Length = 392 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/44 (61%), Positives = 38/44 (86%) Frame = +3 Query: 15 VAGTSGLACGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 VAG + ++CGI++L+++ DTPPD L++LQFGSQESI+SWLDR Sbjct: 348 VAGNNDVSCGISELENLDFDTPPDLPLADLQFGSQESILSWLDR 391 >ref|XP_002272446.1| PREDICTED: NAC domain-containing protein 8 [Vitis vinifera] gi|296087593|emb|CBI34849.3| unnamed protein product [Vitis vinifera] Length = 398 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +3 Query: 15 VAGTSGLACGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 + G CGIADL+++ +DTPPDFQL++LQFGSQ+SI WLDR Sbjct: 354 IPGDHNAPCGIADLENLELDTPPDFQLADLQFGSQDSIFGWLDR 397 >gb|EMJ16704.1| hypothetical protein PRUPE_ppa006948mg [Prunus persica] Length = 389 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +3 Query: 15 VAGTSGLACGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 V G S +CGI DL++I + TPPDFQL++LQF SQ+S++ WLDR Sbjct: 345 VTGNSSTSCGIGDLENIDLGTPPDFQLADLQFCSQDSLLGWLDR 388 >ref|XP_004156732.1| PREDICTED: NAC domain-containing protein 8-like [Cucumis sativus] Length = 518 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 39 CGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 CGIADL+++ +DTPPDF L++LQFGSQESI W+DR Sbjct: 482 CGIADLENLDLDTPPDFHLADLQFGSQESIFDWIDR 517 >ref|XP_004142846.1| PREDICTED: NAC domain-containing protein 8-like [Cucumis sativus] Length = 518 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 39 CGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 CGIADL+++ +DTPPDF L++LQFGSQESI W+DR Sbjct: 482 CGIADLENLDLDTPPDFHLADLQFGSQESIFDWIDR 517 >gb|AHJ79160.1| NAC domain protein NAC19 [Gossypium hirsutum] Length = 398 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 21 GTSGLACGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 G + +CGI++L+++ DTPPD L++LQFGSQESI+SWLDR Sbjct: 356 GNNDASCGISELENLEFDTPPDVTLADLQFGSQESILSWLDR 397 >ref|XP_002521482.1| conserved hypothetical protein [Ricinus communis] gi|223539381|gb|EEF40972.1| conserved hypothetical protein [Ricinus communis] Length = 413 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +3 Query: 15 VAGTSGLACGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 V G + CGIA+L+++ +DTPPDF LS+LQ SQ+SI SW+DR Sbjct: 369 VTGNNNAPCGIAELENLELDTPPDFTLSDLQISSQDSIFSWIDR 412 >ref|XP_004231842.1| PREDICTED: NAC domain-containing protein 8-like [Solanum lycopersicum] Length = 393 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +3 Query: 39 CGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 CGI++LD++ +D+PPDFQL++L FGSQE+I SWLDR Sbjct: 357 CGISELDNLELDSPPDFQLADLPFGSQENIFSWLDR 392 >gb|EXC20358.1| NAC domain-containing protein 8 [Morus notabilis] Length = 1077 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +3 Query: 6 NETVAGTSGLACGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 N G + CGI+DL+++ +DTPPDF L +LQF SQESI+ WLDR Sbjct: 437 NNKSTGENIAPCGISDLENLELDTPPDFHLPDLQFCSQESILDWLDR 483 >ref|XP_006338624.1| PREDICTED: NAC domain-containing protein 8-like [Solanum tuberosum] Length = 418 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +3 Query: 39 CGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 CGI++LD++ D+PPDFQL++L FGSQE+I SWLDR Sbjct: 382 CGISELDNLEPDSPPDFQLADLPFGSQENIFSWLDR 417 >gb|AGL39749.1| NAC transcription factor 093 [Jatropha curcas] Length = 402 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = +3 Query: 6 NETVAGTSGLACGIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 N+ + + GIADL+++ +DTPPDFQ +LQF SQ+SI+ WLDR Sbjct: 355 NQLTTRNNDTSYGIADLENLELDTPPDFQFGDLQFSSQDSILDWLDR 401 >ref|XP_006852355.1| hypothetical protein AMTR_s00049p00217900 [Amborella trichopoda] gi|548855959|gb|ERN13822.1| hypothetical protein AMTR_s00049p00217900 [Amborella trichopoda] Length = 141 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = +3 Query: 42 GIADLDSIIMDTPPDFQLSELQFGSQESIMSWLDR 146 G+++L++I +DTPPD QL +LQFGSQES+M WLDR Sbjct: 101 GLSELENIELDTPPDIQLGDLQFGSQESVMGWLDR 135