BLASTX nr result
ID: Zingiber23_contig00052751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052751 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT07190.1| Serine/threonine-protein phosphatase PP2A-3 catal... 67 2e-09 gb|AEB61013.1| serine/threonine-protein phosphatase 2a catalytic... 63 5e-08 ref|XP_002976892.1| hypothetical protein SELMODRAFT_175936 [Sela... 62 6e-08 gb|EXB74728.1| Serine/threonine-protein phosphatase PP2A catalyt... 62 8e-08 gb|EXB29774.1| Serine/threonine-protein phosphatase PP2A catalyt... 62 8e-08 ref|XP_006930670.1| PREDICTED: serine/threonine-protein phosphat... 62 8e-08 ref|XP_006834587.1| PREDICTED: serine/threonine-protein phosphat... 62 8e-08 ref|XP_006884185.1| PREDICTED: serine/threonine-protein phosphat... 62 8e-08 ref|XP_006731701.1| PREDICTED: serine/threonine-protein phosphat... 62 8e-08 emb|CDM31405.1| Serine/threonine-protein phosphatase PP2A cataly... 62 8e-08 prf||1702228B protein phosphatase 2A 62 8e-08 sp|Q9ZSE4.1|PP2A_HEVBR RecName: Full=Serine/threonine-protein ph... 62 8e-08 ref|NP_001005443.1| protein phosphatase 2, catalytic subunit, be... 62 8e-08 ref|NP_001095177.1| serine/threonine-protein phosphatase 2A cata... 62 8e-08 sp|P23778.2|PP2A_BRANA RecName: Full=Serine/threonine-protein ph... 62 8e-08 emb|CAC13980.1| protein phosphatase 2a [Aspergillus nidulans] 62 8e-08 ref|NP_990455.1| serine/threonine-protein phosphatase 2A catalyt... 62 8e-08 sp|P11493.2|PP2AB_PIG RecName: Full=Serine/threonine-protein pho... 62 8e-08 ref|XP_001223707.1| serine/threonine protein phosphatase PP2A ca... 62 8e-08 ref|XP_750971.1| protein phosphatase 2A catalytic subunit Pph21 ... 62 8e-08 >gb|EMT07190.1| Serine/threonine-protein phosphatase PP2A-3 catalytic subunit [Aegilops tauschii] Length = 352 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 304 GFRYGFYDECLRKYGNANVWKYFTDLFD 387 G+RYGFYDECLRKYGNANVWKYFTDLFD Sbjct: 167 GYRYGFYDECLRKYGNANVWKYFTDLFD 194 >gb|AEB61013.1| serine/threonine-protein phosphatase 2a catalytic subunit alpha isoform-like protein [Equus caballus] Length = 215 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 5/56 (8%) Frame = +1 Query: 235 FLLFEFVASMQLLQMIFIMTISFGFR-----YGFYDECLRKYGNANVWKYFTDLFD 387 F+LF ++ + I I+ + R YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 2 FMLFSVFFQVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFD 57 >ref|XP_002976892.1| hypothetical protein SELMODRAFT_175936 [Selaginella moellendorffii] gi|300155370|gb|EFJ22002.1| hypothetical protein SELMODRAFT_175936 [Selaginella moellendorffii] Length = 308 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 307 FRYGFYDECLRKYGNANVWKYFTDLFD 387 + YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 124 YGYGFYDECLRKYGNANVWKYFTDLFD 150 >gb|EXB74728.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Morus notabilis] Length = 323 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 141 YGFYDECLRKYGNANVWKYFTDLFD 165 >gb|EXB29774.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Morus notabilis] Length = 307 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 125 YGFYDECLRKYGNANVWKYFTDLFD 149 >ref|XP_006930670.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit beta isoform, partial [Felis catus] Length = 292 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 110 YGFYDECLRKYGNANVWKYFTDLFD 134 >ref|XP_006834587.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit beta isoform [Chrysochloris asiatica] Length = 308 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 99 YGFYDECLRKYGNANVWKYFTDLFD 123 >ref|XP_006884185.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit beta isoform [Elephantulus edwardii] Length = 309 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 127 YGFYDECLRKYGNANVWKYFTDLFD 151 >ref|XP_006731701.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit beta isoform, partial [Leptonychotes weddellii] Length = 308 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 126 YGFYDECLRKYGNANVWKYFTDLFD 150 >emb|CDM31405.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Penicillium roqueforti] Length = 329 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 147 YGFYDECLRKYGNANVWKYFTDLFD 171 >prf||1702228B protein phosphatase 2A Length = 309 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 127 YGFYDECLRKYGNANVWKYFTDLFD 151 >sp|Q9ZSE4.1|PP2A_HEVBR RecName: Full=Serine/threonine-protein phosphatase PP2A catalytic subunit gi|3986750|gb|AAD09953.1| serine/threonine protein phosphatase type 2A [Hevea brasiliensis] Length = 306 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFD 148 >ref|NP_001005443.1| protein phosphatase 2, catalytic subunit, beta isoform [Xenopus (Silurana) tropicalis] gi|148234623|ref|NP_001084162.1| protein phosphatase 2, catalytic subunit, beta isozyme [Xenopus laevis] gi|1143703|emb|CAA90704.1| protein phosphatase 2A, catalytic subunit, beta isoform [Xenopus laevis] gi|49118711|gb|AAH72775.1| Ppp2cb protein [Xenopus laevis] gi|49250439|gb|AAH74551.1| novel protein similar to PPP2CB [Xenopus (Silurana) tropicalis] gi|111309124|gb|AAI21642.1| novel protein similar to PPP2CB [Xenopus (Silurana) tropicalis] Length = 309 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 127 YGFYDECLRKYGNANVWKYFTDLFD 151 >ref|NP_001095177.1| serine/threonine-protein phosphatase 2A catalytic subunit beta isoform [Oryctolagus cuniculus] gi|504165601|ref|XP_004592753.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit beta isoform [Ochotona princeps] gi|129336|sp|P11611.1|PP2AB_RABIT RecName: Full=Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; Short=PP2A-beta gi|1685|emb|CAA68732.1| unnamed protein product [Oryctolagus cuniculus] Length = 309 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 127 YGFYDECLRKYGNANVWKYFTDLFD 151 >sp|P23778.2|PP2A_BRANA RecName: Full=Serine/threonine-protein phosphatase PP2A catalytic subunit gi|17848|emb|CAA40687.1| phosphatase 2A [Brassica napus] Length = 309 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 127 YGFYDECLRKYGNANVWKYFTDLFD 151 >emb|CAC13980.1| protein phosphatase 2a [Aspergillus nidulans] Length = 329 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 147 YGFYDECLRKYGNANVWKYFTDLFD 171 >ref|NP_990455.1| serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform [Gallus gallus] gi|1352665|sp|P48463.1|PP2AA_CHICK RecName: Full=Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; Short=PP2A-alpha gi|517098|dbj|BAA04481.1| phosphatase 2A catalytic subunit [Gallus gallus] Length = 309 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 127 YGFYDECLRKYGNANVWKYFTDLFD 151 >sp|P11493.2|PP2AB_PIG RecName: Full=Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; Short=PP2A-beta gi|164298|gb|AAA30982.1| protein phosphatase 2A beta subunit, partial [Sus scrofa] Length = 293 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 111 YGFYDECLRKYGNANVWKYFTDLFD 135 >ref|XP_001223707.1| serine/threonine protein phosphatase PP2A catalytic subunit [Chaetomium globosum CBS 148.51] gi|88180406|gb|EAQ87874.1| serine/threonine protein phosphatase PP2A catalytic subunit [Chaetomium globosum CBS 148.51] Length = 294 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 145 YGFYDECLRKYGNANVWKYFTDLFD 169 >ref|XP_750971.1| protein phosphatase 2A catalytic subunit Pph21 [Aspergillus fumigatus Af293] gi|66848604|gb|EAL88933.1| protein phosphatase 2A catalytic subunit Pph21, putative [Aspergillus fumigatus Af293] gi|159124539|gb|EDP49657.1| protein phosphatase 2a [Aspergillus fumigatus A1163] Length = 329 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 313 YGFYDECLRKYGNANVWKYFTDLFD 387 YGFYDECLRKYGNANVWKYFTDLFD Sbjct: 147 YGFYDECLRKYGNANVWKYFTDLFD 171