BLASTX nr result
ID: Zingiber23_contig00052599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052599 (393 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828265.1| hypothetical protein AMTR_s00023p00210090 [A... 59 5e-07 ref|XP_004958813.1| PREDICTED: serine/threonine-protein kinase P... 59 9e-07 ref|XP_002461283.1| hypothetical protein SORBIDRAFT_02g044090 [S... 57 3e-06 gb|EOY07695.1| Kinase superfamily protein isoform 1 [Theobroma c... 57 3e-06 >ref|XP_006828265.1| hypothetical protein AMTR_s00023p00210090 [Amborella trichopoda] gi|548832912|gb|ERM95681.1| hypothetical protein AMTR_s00023p00210090 [Amborella trichopoda] Length = 402 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +3 Query: 3 LIADVVTALTYLASQTYNPESQLNQNASRISAPGTPPRTRK-ASEKKVGG 149 LIADVVTALTYLASQTY+PE+ Q++SR+ AP TPPR R+ EKK G Sbjct: 335 LIADVVTALTYLASQTYDPEAHPVQSSSRL-APATPPRARRDTMEKKPNG 383 >ref|XP_004958813.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform X1 [Setaria italica] Length = 399 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 3 LIADVVTALTYLASQTYNPESQLNQNASRISAPGTPPRTRKAS 131 LI DVVTALTYLASQTY+PE+ N SR+ APGTPPRT+ +S Sbjct: 348 LIGDVVTALTYLASQTYDPEAHGN---SRLVAPGTPPRTKNSS 387 >ref|XP_002461283.1| hypothetical protein SORBIDRAFT_02g044090 [Sorghum bicolor] gi|241924660|gb|EER97804.1| hypothetical protein SORBIDRAFT_02g044090 [Sorghum bicolor] Length = 404 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +3 Query: 3 LIADVVTALTYLASQTYNPESQLNQNASRISAPGTPPRTR 122 LI DVVTALTYLASQTY+PE+ N S + APGTPPRTR Sbjct: 353 LIGDVVTALTYLASQTYDPEAHAN---SHLVAPGTPPRTR 389 >gb|EOY07695.1| Kinase superfamily protein isoform 1 [Theobroma cacao] Length = 394 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = +3 Query: 3 LIADVVTALTYLASQTYNPESQLNQNASRISAPGTPPRTRKASEKKVGG 149 LIADVVTALTYLASQ + P++Q Q SR+ APGTPPRT++ +KK G Sbjct: 335 LIADVVTALTYLASQKFEPDTQSVQ-GSRL-APGTPPRTKRDRDKKPNG 381