BLASTX nr result
ID: Zingiber23_contig00052551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052551 (360 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554894.2| PREDICTED: phenolic glucoside malonyltransfe... 55 7e-06 >ref|XP_003554894.2| PREDICTED: phenolic glucoside malonyltransferase 1-like [Glycine max] Length = 479 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = -1 Query: 360 KVDMPSIMRGGAISVSESRDKSGGVEIGLVSPKTEMDEFQVHFSNGLKLL 211 KVDM SI + GA VSESR+ +GG+E+ LV K EM+ F HF+ GL+ L Sbjct: 430 KVDMTSIGKTGAFGVSESRNDTGGIEVSLVLNKQEMETFTAHFTQGLESL 479