BLASTX nr result
ID: Zingiber23_contig00051893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00051893 (335 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428340.1| hypothetical protein CICLE_v10013801mg [Citr... 59 9e-07 ref|XP_006428338.1| hypothetical protein CICLE_v10013220mg [Citr... 55 7e-06 ref|XP_006428337.1| hypothetical protein CICLE_v10013222mg [Citr... 55 1e-05 >ref|XP_006428340.1| hypothetical protein CICLE_v10013801mg [Citrus clementina] gi|557530397|gb|ESR41580.1| hypothetical protein CICLE_v10013801mg [Citrus clementina] Length = 87 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/46 (47%), Positives = 37/46 (80%) Frame = -1 Query: 320 STKKIRPSDDDRGYFWFSEPDVDNKASDFIARFHASRYTEADQQAI 183 + ++I PSD+D+G +W +EP +D KASDFIA+FH +R +E+++ A+ Sbjct: 36 TARRIWPSDEDKGGYWVAEPGIDGKASDFIAKFHEARISESERHAV 81 >ref|XP_006428338.1| hypothetical protein CICLE_v10013220mg [Citrus clementina] gi|557530395|gb|ESR41578.1| hypothetical protein CICLE_v10013220mg [Citrus clementina] Length = 87 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/46 (45%), Positives = 36/46 (78%) Frame = -1 Query: 320 STKKIRPSDDDRGYFWFSEPDVDNKASDFIARFHASRYTEADQQAI 183 + ++I PSD+D+G +W +EP +D KAS FIA+FH +R +E+++ A+ Sbjct: 36 TARRIWPSDEDKGAYWVAEPGIDRKASAFIAKFHEARISESERYAV 81 >ref|XP_006428337.1| hypothetical protein CICLE_v10013222mg [Citrus clementina] gi|557530394|gb|ESR41577.1| hypothetical protein CICLE_v10013222mg [Citrus clementina] Length = 87 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/44 (47%), Positives = 34/44 (77%) Frame = -1 Query: 314 KKIRPSDDDRGYFWFSEPDVDNKASDFIARFHASRYTEADQQAI 183 +KI PSD+D+G +W +EP +D KAS FI +FH +R +E+++ A+ Sbjct: 38 RKIWPSDEDKGAYWVAEPGIDRKASAFITKFHEARISESERHAV 81