BLASTX nr result
ID: Zingiber23_contig00051857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00051857 (334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY22801.1| U-box domain-containing protein kinase family pro... 59 7e-07 gb|EOY22800.1| U-box domain-containing protein kinase family pro... 59 7e-07 ref|XP_006358228.1| PREDICTED: U-box domain-containing protein 3... 59 9e-07 ref|XP_004235178.1| PREDICTED: U-box domain-containing protein 3... 59 9e-07 ref|XP_006355617.1| PREDICTED: U-box domain-containing protein 3... 58 1e-06 ref|XP_006655773.1| PREDICTED: U-box domain-containing protein 3... 57 2e-06 ref|XP_004240245.1| PREDICTED: U-box domain-containing protein 3... 57 2e-06 ref|XP_003598188.1| U-box domain-containing protein [Medicago tr... 57 2e-06 ref|XP_006837329.1| hypothetical protein AMTR_s00111p00076670 [A... 57 3e-06 ref|XP_006490171.1| PREDICTED: U-box domain-containing protein 3... 55 7e-06 ref|XP_006490170.1| PREDICTED: U-box domain-containing protein 3... 55 7e-06 gb|EMJ20119.1| hypothetical protein PRUPE_ppa001518mg [Prunus pe... 55 1e-05 ref|NP_001056754.1| Os06g0140800 [Oryza sativa Japonica Group] g... 55 1e-05 gb|AAO72614.1| putative serine/threonine protein kinase [Oryza s... 55 1e-05 >gb|EOY22801.1| U-box domain-containing protein kinase family protein isoform 2 [Theobroma cacao] Length = 817 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSRK 210 AIE WL DKSP+TNLP L+K++ PN +LLSAI +WKSRK Sbjct: 776 AIEKWLDGNDKSPMTNLPLLNKNLLPNYNLLSAIVEWKSRK 816 >gb|EOY22800.1| U-box domain-containing protein kinase family protein isoform 1 [Theobroma cacao] Length = 831 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSRK 210 AIE WL DKSP+TNLP L+K++ PN +LLSAI +WKSRK Sbjct: 790 AIEKWLDGNDKSPMTNLPLLNKNLLPNYNLLSAIVEWKSRK 830 >ref|XP_006358228.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 [Solanum tuberosum] gi|565384622|ref|XP_006358229.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 [Solanum tuberosum] Length = 809 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSR 213 AIE WL +KD SP+T+LP HK++ PN +LLSAI DWKSR Sbjct: 770 AIETWLKEKDISPMTSLPLAHKNLLPNYALLSAILDWKSR 809 >ref|XP_004235178.1| PREDICTED: U-box domain-containing protein 35-like [Solanum lycopersicum] Length = 809 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSR 213 AIE WL +KD SP+T+LP HK++ PN +LLSAI DWKSR Sbjct: 770 AIETWLKEKDISPMTSLPLAHKNLLPNYALLSAILDWKSR 809 >ref|XP_006355617.1| PREDICTED: U-box domain-containing protein 35-like [Solanum tuberosum] Length = 847 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSRKN 207 AIE WL+ D SP+TNLP HK + PN +LLSAI++WKS K+ Sbjct: 806 AIESWLADNDNSPVTNLPLPHKHLLPNYALLSAIKEWKSGKH 847 >ref|XP_006655773.1| PREDICTED: U-box domain-containing protein 35-like [Oryza brachyantha] Length = 804 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSR 213 AIE+WLS DKSP+TNL HK++ PN+SL SAI DW+S+ Sbjct: 764 AIELWLSMNDKSPMTNLRLPHKNLIPNHSLRSAIMDWRSK 803 >ref|XP_004240245.1| PREDICTED: U-box domain-containing protein 35-like [Solanum lycopersicum] Length = 892 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSRKN 207 AIE WL+ D SP+TNLP HK + PN +LLSAI++WKS K+ Sbjct: 851 AIESWLADNDHSPVTNLPLPHKHLLPNYALLSAIKEWKSGKH 892 >ref|XP_003598188.1| U-box domain-containing protein [Medicago truncatula] gi|355487236|gb|AES68439.1| U-box domain-containing protein [Medicago truncatula] Length = 809 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSRK 210 AIE WL +KDKSP+TN+P HK + PN +LLSAI +WKS++ Sbjct: 768 AIEKWLEEKDKSPMTNIPLPHKILIPNYTLLSAILEWKSKE 808 >ref|XP_006837329.1| hypothetical protein AMTR_s00111p00076670 [Amborella trichopoda] gi|548839947|gb|ERN00183.1| hypothetical protein AMTR_s00111p00076670 [Amborella trichopoda] Length = 803 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKS 216 AI+ WLS DKSP+TNLP HK++ PN +LLSAI +WKS Sbjct: 762 AIDKWLSMNDKSPMTNLPMPHKNLVPNFTLLSAIMEWKS 800 >ref|XP_006490171.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 [Citrus sinensis] Length = 802 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSR 213 AIE WL +K+KSPIT+LP +K++ PN +LLSAI DWKS+ Sbjct: 763 AIEEWLQEKNKSPITDLPLPNKNLLPNYTLLSAILDWKSK 802 >ref|XP_006490170.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 [Citrus sinensis] Length = 810 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSR 213 AIE WL +K+KSPIT+LP +K++ PN +LLSAI DWKS+ Sbjct: 771 AIEEWLQEKNKSPITDLPLPNKNLLPNYTLLSAILDWKSK 810 >gb|EMJ20119.1| hypothetical protein PRUPE_ppa001518mg [Prunus persica] Length = 810 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/40 (57%), Positives = 32/40 (80%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSR 213 +IE W+ + DKSP+TNLP +K++ PN +LLSAI +WKSR Sbjct: 769 SIETWIQENDKSPMTNLPLPNKNLIPNYTLLSAIMEWKSR 808 >ref|NP_001056754.1| Os06g0140800 [Oryza sativa Japonica Group] gi|113594794|dbj|BAF18668.1| Os06g0140800 [Oryza sativa Japonica Group] gi|215686770|dbj|BAG89620.1| unnamed protein product [Oryza sativa Japonica Group] gi|218197534|gb|EEC79961.1| hypothetical protein OsI_21572 [Oryza sativa Indica Group] gi|222634928|gb|EEE65060.1| hypothetical protein OsJ_20070 [Oryza sativa Japonica Group] Length = 806 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSR 213 AIE+WLS DKSP+TNL HK + PN+SL SAI DW+++ Sbjct: 766 AIELWLSMNDKSPMTNLRLPHKSLIPNHSLRSAIIDWRTK 805 >gb|AAO72614.1| putative serine/threonine protein kinase [Oryza sativa Japonica Group] Length = 448 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -3 Query: 332 AIEIWLSKKDKSPITNLPFLHKDITPNNSLLSAIRDWKSR 213 AIE+WLS DKSP+TNL HK + PN+SL SAI DW+++ Sbjct: 408 AIELWLSMNDKSPMTNLRLPHKSLIPNHSLRSAIIDWRTK 447