BLASTX nr result
ID: Zingiber23_contig00051736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00051736 (257 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT25790.1| Taxadien-5-alpha-ol O-acetyltransferase [Aegilops... 57 3e-06 gb|EMS58181.1| hypothetical protein TRIUR3_08725 [Triticum urartu] 57 3e-06 >gb|EMT25790.1| Taxadien-5-alpha-ol O-acetyltransferase [Aegilops tauschii] Length = 347 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -1 Query: 257 SFYVSMKNSKGEEGIVVPVCLLAPAMDKFTQEMHNLM 147 SF +++KNSKGE+G+VVPVCL +P MDKF +EM LM Sbjct: 291 SFLIAVKNSKGEDGLVVPVCLPSPVMDKFVEEMRRLM 327 >gb|EMS58181.1| hypothetical protein TRIUR3_08725 [Triticum urartu] Length = 93 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -1 Query: 257 SFYVSMKNSKGEEGIVVPVCLLAPAMDKFTQEMHNLM 147 SF +++KNSKGE+G+VVPVCL +P MDKF +EM LM Sbjct: 37 SFLIAVKNSKGEDGLVVPVCLPSPVMDKFVEEMRRLM 73