BLASTX nr result
ID: Zingiber23_contig00050970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00050970 (220 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511747.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002511747.1| conserved hypothetical protein [Ricinus communis] gi|223548927|gb|EEF50416.1| conserved hypothetical protein [Ricinus communis] Length = 214 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/58 (41%), Positives = 38/58 (65%) Frame = -3 Query: 218 HGGETRLPPPPSVKELDVIPFKLRKIMELRNENFKQGHAPTSKDSRGQKKRKPVSDCD 45 HGG +RLPPPP ++D +PFKLRKI+ + + H ++K S+ ++++P SD D Sbjct: 17 HGGHSRLPPPPDPSQVDALPFKLRKIISITS------HNESAKPSKSSEEKRPSSDAD 68