BLASTX nr result
ID: Zingiber23_contig00050943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00050943 (567 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ01161.1| hypothetical protein PRUPE_ppa026332mg, partial [... 57 3e-06 >gb|EMJ01161.1| hypothetical protein PRUPE_ppa026332mg, partial [Prunus persica] Length = 211 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -1 Query: 567 GKDVFNLEKRSHLYFICGLPGHCESGQKVDIRVL 466 G D L+K H ++ICGLPGHCE+GQKVDIRVL Sbjct: 91 GNDAVELKKAGHFFYICGLPGHCEAGQKVDIRVL 124