BLASTX nr result
ID: Zingiber23_contig00050832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00050832 (310 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY06960.1| Uncharacterized protein TCM_021522 [Theobroma cacao] 43 7e-06 >gb|EOY06960.1| Uncharacterized protein TCM_021522 [Theobroma cacao] Length = 3503 Score = 43.1 bits (100), Expect(2) = 7e-06 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +2 Query: 98 PVIVPLRWNASPCWRRLIKVRSIAEKQIGWIIGKDKLKFWFDTWL 232 P V + + S W+R++ + SI E+ I W +G KL FW D W+ Sbjct: 3028 PTHVQPKLHDSQTWKRMVTISSITEQNIRWRVGHGKLFFWHDCWM 3072 Score = 32.0 bits (71), Expect(2) = 7e-06 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 15 AMKLWHRFREKKTPWAGFLNRLYCG 89 +MKLW RFR + W F+ YCG Sbjct: 3000 SMKLWWRFRTTNSLWMQFMRAKYCG 3024