BLASTX nr result
ID: Zingiber23_contig00050432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00050432 (335 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ89028.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 6e-06 >dbj|BAJ89028.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 188 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/64 (53%), Positives = 39/64 (60%), Gaps = 2/64 (3%) Frame = -1 Query: 227 MCEWARGISRRLLGHPTVGERAPLLEEEWRAP-PKGHLAVYVAEKE-GERARRYVVPAVY 54 M W R ++RR+ P GER LLEE A PKG +AVYV E G + RYVVP VY Sbjct: 78 MLGWGRSLARRMRLLPRRGER--LLEEAGEATTPKGQVAVYVGGDEPGGESMRYVVPVVY 135 Query: 53 FNHP 42 FNHP Sbjct: 136 FNHP 139