BLASTX nr result
ID: Zingiber23_contig00050259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00050259 (444 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595901.1| hypothetical protein MTR_2g063210 [Medicago ... 55 1e-05 >ref|XP_003595901.1| hypothetical protein MTR_2g063210 [Medicago truncatula] gi|355484949|gb|AES66152.1| hypothetical protein MTR_2g063210 [Medicago truncatula] Length = 494 Score = 55.1 bits (131), Expect = 1e-05 Identities = 40/102 (39%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +1 Query: 34 CKLSDTFCKSHGHGRQAKLIDPKSRPRGTISSQGSYCQ-ELTYMVTDELVVIPLSHAEVI 210 C L+ TF G AKL+DPKS S G Y + LT MVTD+LVV P+S + + Sbjct: 366 CPLTCTF----DSGEPAKLVDPKS------SLSGGYIKGPLTIMVTDDLVVTPMSSIDAV 415 Query: 211 SVRNEISDPIKMAE---LSMAEEEVLDFLGVVLSSNTALTDG 327 S + P+ E +S+ EE L L L+S +ALT+G Sbjct: 416 SYLERMKVPLNDVEEIFISIGVEEGLSILKASLTSTSALTNG 457