BLASTX nr result
ID: Zingiber23_contig00050080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00050080 (431 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB58579.1| hypothetical protein L484_008732 [Morus notabilis] 56 6e-06 ref|XP_004144574.1| PREDICTED: uncharacterized protein LOC101220... 55 7e-06 >gb|EXB58579.1| hypothetical protein L484_008732 [Morus notabilis] Length = 226 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = +3 Query: 54 PPSVHLANPHNLPILDNVFDLVFSTGATEALFLARFVSQMEHT 182 PP V A+PHNLP D VFDL FS EALF +RF+S+ME T Sbjct: 127 PPLVDRADPHNLPFFDEVFDLAFSAHLAEALFPSRFMSEMERT 169 >ref|XP_004144574.1| PREDICTED: uncharacterized protein LOC101220368 [Cucumis sativus] Length = 228 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/46 (56%), Positives = 31/46 (67%) Frame = +3 Query: 54 PPSVHLANPHNLPILDNVFDLVFSTGATEALFLARFVSQMEHTRAP 191 PP V A+PHNLP D+VFDL F+ EALF +RFVS+ME P Sbjct: 133 PPLVSRADPHNLPFFDHVFDLAFTAHLAEALFPSRFVSEMERAVRP 178