BLASTX nr result
ID: Zingiber23_contig00049334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049334 (301 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003562226.1| PREDICTED: F-box/LRR-repeat protein 17-like ... 56 6e-06 ref|XP_003562225.1| PREDICTED: F-box/LRR-repeat protein 17-like ... 56 6e-06 >ref|XP_003562226.1| PREDICTED: F-box/LRR-repeat protein 17-like isoform 2 [Brachypodium distachyon] Length = 538 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/58 (48%), Positives = 32/58 (55%), Gaps = 12/58 (20%) Frame = -2 Query: 183 PRPKSRGSYNCGHCGLPKRGHSC------------PTPEAXXXXXXXXXXXRALSFDD 46 PRPK+RGSYNCG CGLPK+GH C P+P + RALSFDD Sbjct: 12 PRPKTRGSYNCGRCGLPKKGHVCNLPSPADGGAPTPSPSSSGAASGENRLRRALSFDD 69 >ref|XP_003562225.1| PREDICTED: F-box/LRR-repeat protein 17-like isoform 1 [Brachypodium distachyon] Length = 575 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/58 (48%), Positives = 32/58 (55%), Gaps = 12/58 (20%) Frame = -2 Query: 183 PRPKSRGSYNCGHCGLPKRGHSC------------PTPEAXXXXXXXXXXXRALSFDD 46 PRPK+RGSYNCG CGLPK+GH C P+P + RALSFDD Sbjct: 12 PRPKTRGSYNCGRCGLPKKGHVCNLPSPADGGAPTPSPSSSGAASGENRLRRALSFDD 69