BLASTX nr result
ID: Zingiber23_contig00049314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049314 (231 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382044.1| hypothetical protein POPTR_0006s25380g [Popu... 56 4e-06 ref|XP_002308597.2| hypothetical protein POPTR_0006s25380g [Popu... 56 4e-06 ref|XP_006596182.1| PREDICTED: receptor-like protein kinase HSL1... 56 6e-06 ref|XP_006596181.1| PREDICTED: receptor-like protein kinase HSL1... 56 6e-06 gb|EXB93392.1| Probably inactive leucine-rich repeat receptor-li... 55 7e-06 >ref|XP_006382044.1| hypothetical protein POPTR_0006s25380g [Populus trichocarpa] gi|550337062|gb|ERP59841.1| hypothetical protein POPTR_0006s25380g [Populus trichocarpa] Length = 945 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 100 TLFSLQVLDLSNNFLAGPIPDEISRFVSLKDLDLGGNYFQGRIP 231 ++F L+ LDLSNN L+G IP EI F SLK LDLGGN G+IP Sbjct: 131 SIFLLETLDLSNNMLSGKIPQEIGSFSSLKFLDLGGNVLVGKIP 174 >ref|XP_002308597.2| hypothetical protein POPTR_0006s25380g [Populus trichocarpa] gi|566178092|ref|XP_006382045.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550337061|gb|EEE92120.2| hypothetical protein POPTR_0006s25380g [Populus trichocarpa] gi|550337063|gb|ERP59842.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 971 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 100 TLFSLQVLDLSNNFLAGPIPDEISRFVSLKDLDLGGNYFQGRIP 231 ++F L+ LDLSNN L+G IP EI F SLK LDLGGN G+IP Sbjct: 143 SIFLLETLDLSNNMLSGKIPQEIGSFSSLKFLDLGGNVLVGKIP 186 >ref|XP_006596182.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 [Glycine max] Length = 883 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +1 Query: 109 SLQVLDLSNNFLAGPIPDEISRFVSLKDLDLGGNYFQGRIP 231 +L++LDLS N+LAGPIP++I++F +L LDLGGN F G IP Sbjct: 119 NLKLLDLSQNYLAGPIPNDIAKFKTLNYLDLGGNSFSGDIP 159 >ref|XP_006596181.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 [Glycine max] Length = 1032 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +1 Query: 109 SLQVLDLSNNFLAGPIPDEISRFVSLKDLDLGGNYFQGRIP 231 +L++LDLS N+LAGPIP++I++F +L LDLGGN F G IP Sbjct: 119 NLKLLDLSQNYLAGPIPNDIAKFKTLNYLDLGGNSFSGDIP 159 >gb|EXB93392.1| Probably inactive leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 975 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 100 TLFSLQVLDLSNNFLAGPIPDEISRFVSLKDLDLGGNYFQGRIP 231 ++ SL+ LDLSNN L+G IP +I RF SLK LDLGGN G IP Sbjct: 151 SISSLETLDLSNNMLSGRIPRDIGRFSSLKFLDLGGNILSGHIP 194