BLASTX nr result
ID: Zingiber23_contig00049305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049305 (421 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551198.1| PREDICTED: ubiquitin-like-specific protease ... 61 2e-07 >ref|XP_003551198.1| PREDICTED: ubiquitin-like-specific protease 1D-like [Glycine max] Length = 586 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = -2 Query: 420 PERFRRKYLSMFGSKWFKSEEASGLRKQIQGLVLEVFGSAMTENDKAE-SPCCHESPEDD 244 PER +RK L MFG +WFK +EAS LR +I L+LE +++T+N +E SP P D Sbjct: 502 PERLKRKDLDMFGRRWFKPQEASNLRVKILKLLLEKLQNSITDNCNSESSPSSSAGPATD 561 Query: 243 CLQ*FDPFPTQCTSDIAEPARSSL 172 C++ T +D E A+ S+ Sbjct: 562 CVETARDSVTGPVTDCVETAQDSV 585