BLASTX nr result
ID: Zingiber23_contig00049275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049275 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170854.1| PREDICTED: protein NDR1-like [Cucumis sativus] 58 1e-06 ref|XP_004136510.1| PREDICTED: protein NDR1-like [Cucumis sativus] 58 1e-06 >ref|XP_004170854.1| PREDICTED: protein NDR1-like [Cucumis sativus] Length = 211 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +3 Query: 168 CEKRHRRLI-IAAKIVSGILFLVGLTILIVWLVLRPTKPTFYLRDATV 308 C+K+ ++LI + I++ +FLV LT+LIVW VLRPTKPTF+L+D TV Sbjct: 9 CKKKRKKLIKLIGAIIAIFIFLVLLTVLIVWAVLRPTKPTFFLQDVTV 56 >ref|XP_004136510.1| PREDICTED: protein NDR1-like [Cucumis sativus] Length = 211 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +3 Query: 168 CEKRHRRLIIAAKIVSGI-LFLVGLTILIVWLVLRPTKPTFYLRDATV 308 C+K+ ++LI + GI +FLV LTILIVW VLRPTKPTF+L+D TV Sbjct: 9 CKKKRKKLIKLIGAIIGIFIFLVLLTILIVWAVLRPTKPTFFLQDVTV 56