BLASTX nr result
ID: Zingiber23_contig00049163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049163 (260 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AER12203.1| chloroplast linalool synthase [Hedychium coccineum] 55 8e-06 >gb|AER12203.1| chloroplast linalool synthase [Hedychium coccineum] Length = 591 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/60 (51%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -2 Query: 259 RAMNGDRMNYTNLFEENFKICAINFDRTAQFFYRDTDRYSE-DGEIKDSVTSLLVEPIEL 83 R +NGDR + FEE K +N RT QFFY+D DRY + DGE K+ V SLL+ PI L Sbjct: 533 RCVNGDR-GAVSSFEEYMKRLVVNMIRTFQFFYQDEDRYGKADGETKNQVMSLLINPILL 591