BLASTX nr result
ID: Zingiber23_contig00048999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00048999 (236 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBW30216.1| Putative WRKY transcription factor [Musa balbisi... 60 4e-07 emb|CBW30178.1| Putative WRKY transcription factor [Musa balbisi... 56 4e-06 >emb|CBW30216.1| Putative WRKY transcription factor [Musa balbisiana] Length = 278 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/55 (54%), Positives = 35/55 (63%) Frame = +1 Query: 70 MGYWKRDXXXXXXXXXXXXLRSLERLVLQLSHHQPPPDCREITDQTVVRFKQVIS 234 MG+ K D LRSLER+V LSH Q P DCREITDQT+ +FK+VIS Sbjct: 1 MGHLKMDGQMEVQEAAAAGLRSLERVVFHLSHQQSPWDCREITDQTIAKFKKVIS 55 >emb|CBW30178.1| Putative WRKY transcription factor [Musa balbisiana] Length = 243 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 127 LRSLERLVLQLSHHQPPPDCREITDQTVVRFKQVIS 234 LRSLER+V LSH Q P DCREITDQT+ +FK+VIS Sbjct: 15 LRSLERVVFHLSHQQSPWDCREITDQTIAKFKKVIS 50