BLASTX nr result
ID: Zingiber23_contig00048906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00048906 (232 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428311.1| hypothetical protein CICLE_v10011168mg [Citr... 74 2e-11 ref|XP_003559314.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_004304930.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 gb|EOY11759.1| Pentatricopeptide repeat superfamily protein, put... 69 5e-10 gb|EOY11758.1| Pentatricopeptide repeat superfamily protein, put... 69 5e-10 gb|EMJ09543.1| hypothetical protein PRUPE_ppa002033mg [Prunus pe... 69 5e-10 ref|XP_004231306.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_006358534.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002329996.1| predicted protein [Populus trichocarpa] gi|5... 68 1e-09 ref|XP_002512576.1| pentatricopeptide repeat-containing protein,... 68 1e-09 gb|EMT22006.1| hypothetical protein F775_08914 [Aegilops tauschii] 65 1e-08 emb|CBI39664.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002276575.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 emb|CAN65741.1| hypothetical protein VITISV_037758 [Vitis vinifera] 65 1e-08 gb|EXB57540.1| hypothetical protein L484_022645 [Morus notabilis] 64 3e-08 ref|XP_002318926.1| hypothetical protein POPTR_0013s00430g [Popu... 62 8e-08 ref|XP_006650722.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_006605783.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_004495618.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|NP_001051548.2| Os03g0795400 [Oryza sativa Japonica Group] g... 57 2e-06 >ref|XP_006428311.1| hypothetical protein CICLE_v10011168mg [Citrus clementina] gi|557530368|gb|ESR41551.1| hypothetical protein CICLE_v10011168mg [Citrus clementina] Length = 729 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/58 (56%), Positives = 44/58 (75%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 +Q+L+ L P +L+ VLD+ D++SA K FKW S Q+RFQHTA+TY MIL+LGL GN Sbjct: 54 IQSLRHNLSPDQLIRVLDNTNDLSSAFKIFKWVSIQKRFQHTADTYCKMILKLGLAGN 111 >ref|XP_003559314.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Brachypodium distachyon] Length = 495 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/58 (56%), Positives = 43/58 (74%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 +++LK L P++L VLDS D+ AL+ FKWAS+QR F HTA+TYA MI +LG VGN Sbjct: 48 IRSLKNNLQPERLTRVLDSTSDLNLALRIFKWASSQRIFVHTADTYACMISKLGAVGN 105 >ref|XP_004304930.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 530 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 43/58 (74%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 +Q+LK L P L VLD+ D++SA+K FKWAS Q+RF HTAETY ++L+LGL GN Sbjct: 53 IQSLKTKLVPDNLARVLDNTDDLSSAVKLFKWASLQKRFTHTAETYFKIVLKLGLAGN 110 >gb|EOY11759.1| Pentatricopeptide repeat superfamily protein, putative isoform 2, partial [Theobroma cacao] Length = 726 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/58 (53%), Positives = 41/58 (70%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 ++ L+ L+P L+ VLD D+ SALK FKWA+ Q+RF HTA TY +IL+LGL GN Sbjct: 52 IKFLRNNLYPDSLIRVLDKTQDLNSALKIFKWAALQKRFNHTANTYYHIILKLGLAGN 109 >gb|EOY11758.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 739 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/58 (53%), Positives = 41/58 (70%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 ++ L+ L+P L+ VLD D+ SALK FKWA+ Q+RF HTA TY +IL+LGL GN Sbjct: 53 IKFLRNNLYPDSLIRVLDKTQDLNSALKIFKWAALQKRFNHTANTYYHIILKLGLAGN 110 >gb|EMJ09543.1| hypothetical protein PRUPE_ppa002033mg [Prunus persica] Length = 725 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVG 57 +Q+L+ L P L+ VLD+ D++SA+K FKWAS QRRF HTA+TY +IL+LGL G Sbjct: 50 IQSLRNKLVPDNLIRVLDNTDDLSSAVKVFKWASLQRRFNHTADTYYRIILKLGLAG 106 >ref|XP_004231306.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Solanum lycopersicum] Length = 736 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVG 57 +Q LK LHP+ LV VL S D+ S+LK FKWAS Q+RF H+A+TY +IL+LG+ G Sbjct: 53 IQYLKNKLHPETLVGVLHSTADLDSSLKLFKWASLQKRFHHSADTYFQIILKLGMAG 109 >ref|XP_006358534.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565385270|ref|XP_006358535.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565385272|ref|XP_006358536.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 736 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVG 57 +Q LK LHP+ VLDS D+ S+LK FKWAS Q+RF H+A+TY +IL+LG+ G Sbjct: 53 IQFLKNKLHPETFAGVLDSTADLDSSLKLFKWASLQKRFHHSADTYFQIILKLGMAG 109 >ref|XP_002329996.1| predicted protein [Populus trichocarpa] gi|566168567|ref|XP_006382266.1| hypothetical protein POPTR_0005s00500g [Populus trichocarpa] gi|550337620|gb|ERP60063.1| hypothetical protein POPTR_0005s00500g [Populus trichocarpa] Length = 725 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 +Q+L+ L+P L+ VL S DV SA+K FKWA+ QR+F HTA+TY +I +LG+ GN Sbjct: 50 IQSLRNKLYPDNLIKVLKSTSDVNSAVKIFKWAALQRKFNHTADTYYWIIFKLGMAGN 107 >ref|XP_002512576.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548537|gb|EEF50028.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 739 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 + L+ L+P L+ VL S D+ SA+K FKWAS Q+RF HT++TY +IL+LGL GN Sbjct: 64 IHILRNKLYPDSLIKVLQSTSDINSAVKIFKWASLQKRFNHTSDTYFWIILKLGLAGN 121 >gb|EMT22006.1| hypothetical protein F775_08914 [Aegilops tauschii] Length = 1314 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/59 (55%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = -3 Query: 227 VQALKGG-LHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 +++LK L P+ L VLDS D+ AL+ FKWAS+QR F HTA+TYA MI +LG+VGN Sbjct: 48 IRSLKNNNLRPEILTRVLDSTSDLNLALRIFKWASSQRIFAHTADTYACMISKLGVVGN 106 >emb|CBI39664.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = -3 Query: 224 QALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVG 57 Q L+ L P L+ VLD+ D+ SA+K FKWAS Q+RF+HTA+TY +IL+LG+ G Sbjct: 33 QFLRNRLMPDDLIRVLDTTHDLNSAIKVFKWASRQKRFRHTADTYFRVILKLGMGG 88 >ref|XP_002276575.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62590-like [Vitis vinifera] Length = 730 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = -3 Query: 224 QALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVG 57 Q L+ L P L+ VLD+ D+ SA+K FKWAS Q+RF+HTA+TY +IL+LG+ G Sbjct: 56 QFLRNRLMPDDLIRVLDTTHDLNSAIKVFKWASRQKRFRHTADTYFRVILKLGMGG 111 >emb|CAN65741.1| hypothetical protein VITISV_037758 [Vitis vinifera] Length = 730 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = -3 Query: 224 QALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVG 57 Q L+ L P L+ VLD+ D+ SA+K FKWAS Q+RF+HTA+TY +IL+LG+ G Sbjct: 56 QFLRNRLMPDDLIRVLDTTHDLNSAIKVFKWASRQKRFRHTADTYFRVILKLGMGG 111 >gb|EXB57540.1| hypothetical protein L484_022645 [Morus notabilis] Length = 727 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 ++ L+ L P L+ VLD+ D++SA+K FKWAS Q RF HT +TY +IL+LGL GN Sbjct: 53 IRFLRNKLVPDNLIRVLDNTDDLSSAVKIFKWASLQNRFCHTPDTYNRIILKLGLAGN 110 >ref|XP_002318926.1| hypothetical protein POPTR_0013s00430g [Populus trichocarpa] gi|222857302|gb|EEE94849.1| hypothetical protein POPTR_0013s00430g [Populus trichocarpa] Length = 724 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/58 (50%), Positives = 39/58 (67%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 +Q+L+ L P L+ VL S D+ SA+K FKWAS QRRF HT +TY +I +LG+ N Sbjct: 50 IQSLRNKLCPDYLIKVLKSTSDINSAVKLFKWASLQRRFNHTDDTYYWIIFKLGMAEN 107 >ref|XP_006650722.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Oryza brachyantha] Length = 722 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 +++L+ P++L H+LDS D AL+ F+WAS QR HT +TYA MI +LG GN Sbjct: 51 IRSLRSNPQPERLAHILDSASDFNLALRIFRWASYQRMPIHTVDTYASMIAKLGDAGN 108 >ref|XP_006605783.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like isoform X1 [Glycine max] Length = 249 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = -3 Query: 218 LKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVG 57 LK L P L+ VLD D+ SA++ FKWAS Q+ F HT+ TY +IL+LG+ G Sbjct: 37 LKNKLAPDNLIRVLDRTSDLNSAVRIFKWASRQKSFHHTSNTYFRIILKLGMAG 90 >ref|XP_004495618.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Cicer arietinum] gi|502116863|ref|XP_004495619.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X2 [Cicer arietinum] Length = 717 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/58 (46%), Positives = 37/58 (63%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 + L+ L P L+ VL+ D+ SA+K FKWAS Q+ F H + TY +IL+LGL GN Sbjct: 47 INFLRNKLAPDNLIQVLNRTSDLNSAVKIFKWASIQKSFHHNSNTYFEIILKLGLAGN 104 >ref|NP_001051548.2| Os03g0795400 [Oryza sativa Japonica Group] gi|222625958|gb|EEE60090.1| hypothetical protein OsJ_12941 [Oryza sativa Japonica Group] gi|255674962|dbj|BAF13462.2| Os03g0795400 [Oryza sativa Japonica Group] Length = 728 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = -3 Query: 227 VQALKGGLHPQKLVHVLDSMLDVTSALKAFKWASTQRRFQHTAETYAGMILRLGLVGN 54 +++L+ P++L H+LDS D AL+ F+WAS QR HT +TYA MI +LG GN Sbjct: 56 IRSLRINPQPERLAHILDSASDFNLALRIFRWASYQRMPIHTVDTYARMIAKLGDAGN 113