BLASTX nr result
ID: Zingiber23_contig00048873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00048873 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23503.3| unnamed protein product [Vitis vinifera] 89 4e-17 ref|YP_588306.1| hypothetical protein ZeamMp044 [Zea mays subsp.... 83 4e-14 ref|YP_173426.1| hypothetical protein NitaMp085 [Nicotiana tabac... 74 5e-13 gb|EOY31163.1| Uncharacterized protein TCM_038148 [Theobroma cacao] 75 7e-12 gb|AEZ03709.1| hypothetical protein (mitochondrion) [Oryza sativ... 72 8e-11 >emb|CBI23503.3| unnamed protein product [Vitis vinifera] Length = 526 Score = 89.4 bits (220), Expect(2) = 4e-17 Identities = 42/52 (80%), Positives = 44/52 (84%), Gaps = 4/52 (7%) Frame = +1 Query: 88 FRLGPGKRWQEHKGRGPCSCCARPL----SSRFGIY*KRENPLQITTSVLGS 231 FRLGPGKRWQ+ KGRGPCSCCARPL SRFGIY KRENPLQITT +LGS Sbjct: 193 FRLGPGKRWQQQKGRGPCSCCARPLLSQWGSRFGIYYKRENPLQITTPLLGS 244 Score = 23.9 bits (50), Expect(2) = 4e-17 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 Query: 38 FLSFSSKTKKAE 73 F+ FSSKTKKAE Sbjct: 165 FICFSSKTKKAE 176 >ref|YP_588306.1| hypothetical protein ZeamMp044 [Zea mays subsp. mays] gi|40795129|gb|AAR91173.1| hypothetical protein (mitochondrion) [Zea mays] gi|102579662|gb|ABF70942.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] Length = 101 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/68 (58%), Positives = 45/68 (66%), Gaps = 12/68 (17%) Frame = +1 Query: 16 ILKGRSRFSFFFIENEEGRVHTAI------------FRLGPGKRWQEHKGRGPCSCCARP 159 + K S FFIE EEGR +++ FRLGPGKRWQ+HK RGPCSCCARP Sbjct: 25 VRKTLSEIDLFFIEKEEGRGDSSLPSGFACRRSNKEFRLGPGKRWQQHKERGPCSCCARP 84 Query: 160 LSSRFGIY 183 LSSRFGIY Sbjct: 85 LSSRFGIY 92 >ref|YP_173426.1| hypothetical protein NitaMp085 [Nicotiana tabacum] gi|56806590|dbj|BAD83491.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 162 Score = 73.9 bits (180), Expect(2) = 5e-13 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +3 Query: 165 QQVRHLLEKRESTSDNHVCARQRVEWPRADPEGYIIQAESGV 290 QQVRHLL+KRESTSDNHV ARQRVEWPRAD GYIIQ ES V Sbjct: 116 QQVRHLLQKRESTSDNHVSARQRVEWPRADLFGYIIQVESRV 157 Score = 25.8 bits (55), Expect(2) = 5e-13 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 89 SGSARESAGKNIKE 130 SGSARESAG N KE Sbjct: 86 SGSARESAGNNRKE 99 >gb|EOY31163.1| Uncharacterized protein TCM_038148 [Theobroma cacao] Length = 538 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +3 Query: 165 QQVRHLLEKRESTSDNHVCARQRVEWPRADPEGYIIQAESGV 290 +QVRHLLEKRESTSDNH ARQRVEWPRAD GYIIQ ESGV Sbjct: 492 EQVRHLLEKRESTSDNHASARQRVEWPRADLFGYIIQVESGV 533 >gb|AEZ03709.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group] gi|374277705|gb|AEZ03810.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group] Length = 164 Score = 72.0 bits (175), Expect = 8e-11 Identities = 38/64 (59%), Positives = 39/64 (60%), Gaps = 12/64 (18%) Frame = -3 Query: 179 MPNLLLSGRAQQLHGPLPLCSCQRFPGPSRK------------MAVCTRPSSFSMKKKEN 36 MPNLLLSGRAQQLHGPL LC CQRFPGPSR + RPSSFSMK K Sbjct: 1 MPNLLLSGRAQQLHGPLSLCCCQRFPGPSRNSLLERRQAKPEGRQLSPRPSSFSMKNKST 60 Query: 35 LDLP 24 P Sbjct: 61 SQSP 64