BLASTX nr result
ID: Zingiber23_contig00048755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00048755 (407 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244099.1| PREDICTED: 1,4-alpha-glucan-branching enzyme... 55 7e-06 >ref|XP_004244099.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic-like [Solanum lycopersicum] Length = 903 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 96 EPEIDPVGFLSRFGISHRAFAQFLRDRYKALK 1 E IDPVGFLS++GI+H+AFAQFLR+RYK+LK Sbjct: 72 EKGIDPVGFLSKYGITHKAFAQFLRERYKSLK 103