BLASTX nr result
ID: Zingiber23_contig00048717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00048717 (249 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_006432131.1| hypothetical protein CICLE_v10000792mg [Citr... 70 2e-10 emb|CAN60200.1| hypothetical protein VITISV_039678 [Vitis vinifera] 70 3e-10 ref|XP_004306198.1| PREDICTED: pentatricopeptide repeat-containi... 69 6e-10 gb|EMJ00171.1| hypothetical protein PRUPE_ppa015078mg [Prunus pe... 69 8e-10 gb|ESW10509.1| hypothetical protein PHAVU_009G215700g [Phaseolus... 67 2e-09 ref|XP_004516335.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_003598203.1| Pentatricopeptide repeat-containing protein ... 67 2e-09 ref|NP_001061654.1| Os08g0369200 [Oryza sativa Japonica Group] g... 67 3e-09 gb|EAZ06775.1| hypothetical protein OsI_29018 [Oryza sativa Indi... 67 3e-09 gb|EOY19411.1| Tetratricopeptide repeat-like superfamily protein... 66 4e-09 ref|XP_004966841.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 66 5e-09 gb|AFW86560.1| hypothetical protein ZEAMMB73_703962 [Zea mays] 66 5e-09 gb|AFW73673.1| hypothetical protein ZEAMMB73_530264 [Zea mays] 66 5e-09 ref|XP_002450782.1| hypothetical protein SORBIDRAFT_05g018050 [S... 66 5e-09 gb|EMT12725.1| hypothetical protein F775_22710 [Aegilops tauschii] 65 7e-09 gb|EMS60949.1| hypothetical protein TRIUR3_17217 [Triticum urartu] 65 7e-09 dbj|BAK06692.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 7e-09 dbj|BAJ90952.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 7e-09 ref|XP_006660086.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 >ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|296088528|emb|CBI37519.3| unnamed protein product [Vitis vinifera] Length = 525 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQSDML+TWRRLK K+EEE + FG+EFQQYHFKPY+R Sbjct: 487 GLIQSDMLKTWRRLKKKLEEESITFGSEFQQYHFKPYRR 525 >ref|XP_006432131.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|567879147|ref|XP_006432132.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|568821248|ref|XP_006465094.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X1 [Citrus sinensis] gi|568821250|ref|XP_006465095.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X2 [Citrus sinensis] gi|557534253|gb|ESR45371.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|557534254|gb|ESR45372.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] Length = 540 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQSDMLRTWRRLK K++EE + FG+EFQ YHFKPY+R Sbjct: 502 GLIQSDMLRTWRRLKKKLDEESITFGSEFQNYHFKPYRR 540 >emb|CAN60200.1| hypothetical protein VITISV_039678 [Vitis vinifera] Length = 525 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQSDML+TWRRLK K+EEE + FG+EFQ YHFKPY+R Sbjct: 487 GLIQSDMLKTWRRLKKKLEEESITFGSEFQXYHFKPYRR 525 >ref|XP_004306198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 501 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQSDMLRTWRRLK K++EE + FGAEFQ YH KPY+R Sbjct: 463 GLIQSDMLRTWRRLKKKLDEESVTFGAEFQNYHLKPYRR 501 >gb|EMJ00171.1| hypothetical protein PRUPE_ppa015078mg [Prunus persica] Length = 480 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQSDMLRTWRRLK K++EE + FG+EFQ YH KPY+R Sbjct: 442 GLIQSDMLRTWRRLKKKLDEESISFGSEFQNYHLKPYRR 480 >gb|ESW10509.1| hypothetical protein PHAVU_009G215700g [Phaseolus vulgaris] Length = 509 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK K++EE + FG+EFQ YH KPY+R Sbjct: 471 GLIQADMLRTWRRLKKKLDEESITFGSEFQNYHLKPYRR 509 >ref|XP_004516335.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X1 [Cicer arietinum] Length = 512 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK K++EE + FG+EFQ YH KPY+R Sbjct: 474 GLIQADMLRTWRRLKKKLDEESITFGSEFQNYHLKPYRR 512 >ref|XP_003598203.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355487251|gb|AES68454.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 503 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQSDMLRTWRRLK ++++E + FG+EFQ YH KPYKR Sbjct: 465 GLIQSDMLRTWRRLKKRLDQESITFGSEFQNYHLKPYKR 503 >ref|NP_001061654.1| Os08g0369200 [Oryza sativa Japonica Group] gi|113623623|dbj|BAF23568.1| Os08g0369200 [Oryza sativa Japonica Group] gi|125603197|gb|EAZ42522.1| hypothetical protein OsJ_27088 [Oryza sativa Japonica Group] gi|215740653|dbj|BAG97309.1| unnamed protein product [Oryza sativa Japonica Group] Length = 511 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG EF+ YH KPYKR Sbjct: 473 GLIQADMLRTWRRLKKRVDEEAAKFGEEFKPYHIKPYKR 511 >gb|EAZ06775.1| hypothetical protein OsI_29018 [Oryza sativa Indica Group] Length = 511 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG EF+ YH KPYKR Sbjct: 473 GLIQADMLRTWRRLKKRVDEEAAKFGEEFKPYHIKPYKR 511 >gb|EOY19411.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 612 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQS+MLRTWRRLK K++EE L FG+EFQ YH KPY+R Sbjct: 574 GLIQSNMLRTWRRLKKKLDEESLIFGSEFQDYHLKPYRR 612 >ref|XP_004966841.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Setaria italica] Length = 526 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG EF+ YH KPYKR Sbjct: 488 GLIQADMLRTWRRLKRRVDEEAAKFGDEFKLYHMKPYKR 526 >gb|AFW86560.1| hypothetical protein ZEAMMB73_703962 [Zea mays] Length = 287 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG EF+ YH KPYKR Sbjct: 249 GLIQADMLRTWRRLKRRVDEEAAKFGDEFKLYHMKPYKR 287 >gb|AFW73673.1| hypothetical protein ZEAMMB73_530264 [Zea mays] Length = 526 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG EF+ YH KPYKR Sbjct: 488 GLIQADMLRTWRRLKRRVDEEAAKFGDEFKLYHMKPYKR 526 >ref|XP_002450782.1| hypothetical protein SORBIDRAFT_05g018050 [Sorghum bicolor] gi|241936625|gb|EES09770.1| hypothetical protein SORBIDRAFT_05g018050 [Sorghum bicolor] Length = 528 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG EF+ YH KPYKR Sbjct: 490 GLIQADMLRTWRRLKRRVDEEAAKFGDEFKLYHMKPYKR 528 >gb|EMT12725.1| hypothetical protein F775_22710 [Aegilops tauschii] Length = 349 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG E++ YH KPYKR Sbjct: 311 GLIQADMLRTWRRLKKRVDEESAKFGDEYKSYHIKPYKR 349 >gb|EMS60949.1| hypothetical protein TRIUR3_17217 [Triticum urartu] Length = 349 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG E++ YH KPYKR Sbjct: 311 GLIQADMLRTWRRLKKRVDEESAKFGDEYKSYHIKPYKR 349 >dbj|BAK06692.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 522 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG E++ YH KPYKR Sbjct: 484 GLIQADMLRTWRRLKKRVDEESAKFGDEYKSYHIKPYKR 522 >dbj|BAJ90952.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 263 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG E++ YH KPYKR Sbjct: 225 GLIQADMLRTWRRLKKRVDEESAKFGDEYKSYHIKPYKR 263 >ref|XP_006660086.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like, partial [Oryza brachyantha] Length = 381 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 249 GLIQSDMLRTWRRLKNKVEEEYLKFGAEFQQYHFKPYKR 133 GLIQ+DMLRTWRRLK +V+EE KFG EF+ YH +PYKR Sbjct: 343 GLIQADMLRTWRRLKKRVDEEAAKFGEEFKPYHIQPYKR 381