BLASTX nr result
ID: Zingiber23_contig00048684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00048684 (243 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF21695.1| NBS-type resistance protein RGC5 [Musa acuminata ... 56 4e-06 >gb|ACF21695.1| NBS-type resistance protein RGC5 [Musa acuminata subsp. malaccensis] Length = 1442 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = -1 Query: 240 IYDCPQIQSLPEKGLPPCLTNLDFEGCNLALEQQLGNHLVEIKKS 106 + DCPQIQSLP KGLP LT+L F+ C+ L QL HL E+K S Sbjct: 1390 VSDCPQIQSLPSKGLPTLLTDLGFDHCHPVLTAQLEKHLAEMKSS 1434