BLASTX nr result
ID: Zingiber23_contig00048581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00048581 (213 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29431.3| unnamed protein product [Vitis vinifera] 57 3e-06 gb|EOY15834.1| Set domain protein, putative isoform 4 [Theobroma... 55 7e-06 gb|EOY15831.1| Set domain protein, putative isoform 1 [Theobroma... 55 7e-06 >emb|CBI29431.3| unnamed protein product [Vitis vinifera] Length = 1127 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 5/70 (7%) Frame = -1 Query: 213 GLSSGFLPEELPVYPVINGSISTSVTLKYLKQF-----SSPRYYPSSVDATARDENSQLA 49 GLS+GFLP+ELPVYPV+NG++ V LKY KQF + Y + + AT R N Sbjct: 63 GLSTGFLPDELPVYPVVNGNLINPVPLKYFKQFPDHVATGFAYLSAGISATIRPTNLTAH 122 Query: 48 GKDPVSYFSS 19 +D F++ Sbjct: 123 RQDGTVEFAA 132 >gb|EOY15834.1| Set domain protein, putative isoform 4 [Theobroma cacao] Length = 1235 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 213 GLSSGFLPEELPVYPVINGSISTSVTLKYLKQF 115 GLS+GFLP+ELPVYPV+NG++S V LKY +QF Sbjct: 116 GLSTGFLPDELPVYPVVNGTVSNPVPLKYFRQF 148 >gb|EOY15831.1| Set domain protein, putative isoform 1 [Theobroma cacao] gi|508723935|gb|EOY15832.1| Set domain protein, putative isoform 1 [Theobroma cacao] gi|508723936|gb|EOY15833.1| Set domain protein, putative isoform 1 [Theobroma cacao] Length = 1241 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 213 GLSSGFLPEELPVYPVINGSISTSVTLKYLKQF 115 GLS+GFLP+ELPVYPV+NG++S V LKY +QF Sbjct: 116 GLSTGFLPDELPVYPVVNGTVSNPVPLKYFRQF 148