BLASTX nr result
ID: Zingiber23_contig00048306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00048306 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272922.1| PREDICTED: uncharacterized protein LOC100265... 61 1e-07 ref|XP_002522585.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_006362409.1| PREDICTED: uncharacterized protein LOC102590... 59 9e-07 ref|XP_004134660.1| PREDICTED: uncharacterized protein LOC101214... 59 9e-07 ref|XP_004233081.1| PREDICTED: uncharacterized protein LOC101258... 58 1e-06 gb|EOY27994.1| Uncharacterized protein TCM_029694 [Theobroma cacao] 57 2e-06 ref|XP_003546030.1| PREDICTED: uncharacterized protein LOC100775... 57 2e-06 ref|XP_002305067.1| hypothetical protein POPTR_0004s05620g [Popu... 56 4e-06 gb|ESW31445.1| hypothetical protein PHAVU_002G238700g [Phaseolus... 55 7e-06 gb|ESW20040.1| hypothetical protein PHAVU_006G175900g [Phaseolus... 55 7e-06 ref|XP_004293948.1| PREDICTED: uncharacterized protein LOC101296... 55 7e-06 >ref|XP_002272922.1| PREDICTED: uncharacterized protein LOC100265230 [Vitis vinifera] Length = 182 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -1 Query: 252 LNERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISETSMEL 124 +++RYLSEILSEK+S +RRRGRVGVWRPHL+SISET +L Sbjct: 141 ISDRYLSEILSEKISTQR-DRRRGRVGVWRPHLESISETPSDL 182 >ref|XP_002522585.1| conserved hypothetical protein [Ricinus communis] gi|223538276|gb|EEF39885.1| conserved hypothetical protein [Ricinus communis] Length = 197 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 252 LNERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISETS 133 +++RYLSEILSEK+S +RRRGRVGVWRPHL+SISETS Sbjct: 156 ISDRYLSEILSEKISTQR-DRRRGRVGVWRPHLESISETS 194 >ref|XP_006362409.1| PREDICTED: uncharacterized protein LOC102590379 [Solanum tuberosum] Length = 192 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 249 NERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISETSM 130 N++YLSEILSEKVS +RRRGRVGVWRPHL+SISE ++ Sbjct: 151 NDQYLSEILSEKVSTQR-DRRRGRVGVWRPHLESISEAAI 189 >ref|XP_004134660.1| PREDICTED: uncharacterized protein LOC101214777 [Cucumis sativus] gi|449479227|ref|XP_004155541.1| PREDICTED: uncharacterized protein LOC101227724 [Cucumis sativus] Length = 167 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -1 Query: 252 LNERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISETSMEL 124 +++RYLSEILSEK++ ++RRGRVGVWRPHL+SISE +L Sbjct: 125 VSDRYLSEILSEKLTTVQKDKRRGRVGVWRPHLESISEFPTDL 167 >ref|XP_004233081.1| PREDICTED: uncharacterized protein LOC101258519 [Solanum lycopersicum] Length = 191 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 249 NERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISETS 133 N++YLSEILSEKVS +RRRGRVGVWRPHL+SISE + Sbjct: 150 NDQYLSEILSEKVSTQR-DRRRGRVGVWRPHLESISEAA 187 >gb|EOY27994.1| Uncharacterized protein TCM_029694 [Theobroma cacao] Length = 197 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -1 Query: 252 LNERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISET 136 ++++YLSEILSEK+S +RRRGRVGVWRPHL+SISET Sbjct: 156 ISDQYLSEILSEKLSTQR-DRRRGRVGVWRPHLESISET 193 >ref|XP_003546030.1| PREDICTED: uncharacterized protein LOC100775708 [Glycine max] Length = 176 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 249 NERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISET 136 NERYL+EILSEKVS +RRRGRV VWRPHL+SISE+ Sbjct: 134 NERYLTEILSEKVSTQR-DRRRGRVAVWRPHLESISES 170 >ref|XP_002305067.1| hypothetical protein POPTR_0004s05620g [Populus trichocarpa] gi|222848031|gb|EEE85578.1| hypothetical protein POPTR_0004s05620g [Populus trichocarpa] Length = 178 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 252 LNERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISE 139 ++++YLSEILSEK+S +RRRGRVGVWRPHL+SISE Sbjct: 137 ISDQYLSEILSEKISTQR-DRRRGRVGVWRPHLESISE 173 >gb|ESW31445.1| hypothetical protein PHAVU_002G238700g [Phaseolus vulgaris] Length = 168 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -1 Query: 252 LNERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISETSMEL 124 +++RYL++ILSEKVS ERRRGRV VWRPHL+SISE+ L Sbjct: 127 VSDRYLTDILSEKVSTQR-ERRRGRVAVWRPHLESISESPSHL 168 >gb|ESW20040.1| hypothetical protein PHAVU_006G175900g [Phaseolus vulgaris] Length = 250 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -1 Query: 249 NERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISETSMEL 124 N+RYL+EILSEK+S +RRRGRV VWRPHL+SISE+ ++ Sbjct: 210 NDRYLTEILSEKLSTQR-DRRRGRVAVWRPHLESISESPPDI 250 >ref|XP_004293948.1| PREDICTED: uncharacterized protein LOC101296184 [Fragaria vesca subsp. vesca] Length = 169 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -1 Query: 252 LNERYLSEILSEKVSLGYIERRRGRVGVWRPHLDSISETSMEL 124 ++++YLSEILSEKVS +RRRGRVGVWRPHL+SI E+ ++ Sbjct: 128 ISDQYLSEILSEKVSTQR-DRRRGRVGVWRPHLESICESPSDV 169