BLASTX nr result
ID: Zingiber23_contig00048185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00048185 (289 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT29735.1| hypothetical protein F775_01185 [Aegilops tauschii] 67 3e-09 gb|EMS64484.1| hypothetical protein TRIUR3_18208 [Triticum urartu] 65 7e-09 >gb|EMT29735.1| hypothetical protein F775_01185 [Aegilops tauschii] Length = 672 Score = 66.6 bits (161), Expect = 3e-09 Identities = 38/68 (55%), Positives = 50/68 (73%) Frame = +3 Query: 60 ECSSLRDAALKGFVNDSIPETGPLSGSSNSGSEKADLSVSDKELANSMISFLLPRAVPLL 239 +C+ + D L +V S E G LS SS GSEK+DL V++KE+A SM++FLLP+A+PLL Sbjct: 275 KCTLVNDN-LGDYVPSSSQEDG-LSSSSYLGSEKSDLEVAEKEVARSMMTFLLPQAIPLL 332 Query: 240 EKTYVRRK 263 EKTY RRK Sbjct: 333 EKTYRRRK 340 >gb|EMS64484.1| hypothetical protein TRIUR3_18208 [Triticum urartu] Length = 774 Score = 65.5 bits (158), Expect = 7e-09 Identities = 37/68 (54%), Positives = 50/68 (73%) Frame = +3 Query: 60 ECSSLRDAALKGFVNDSIPETGPLSGSSNSGSEKADLSVSDKELANSMISFLLPRAVPLL 239 +C+ + D L +V +S E G LS SS GSEK+DL ++KE+A SM++FLLP+A+PLL Sbjct: 224 KCTLVNDN-LGDYVPNSSQEDG-LSSSSYLGSEKSDLEAAEKEVARSMMTFLLPQAIPLL 281 Query: 240 EKTYVRRK 263 EKTY RRK Sbjct: 282 EKTYRRRK 289