BLASTX nr result
ID: Zingiber23_contig00047587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00047587 (442 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006478092.1| PREDICTED: uncharacterized protein LOC102630... 59 5e-07 ref|XP_006441258.1| hypothetical protein CICLE_v10021557mg [Citr... 56 4e-06 >ref|XP_006478092.1| PREDICTED: uncharacterized protein LOC102630660 [Citrus sinensis] Length = 279 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +3 Query: 3 HSVDAEVEGLPEVGEFSSEENGEGVE--AVEKAVFVRRHFWKWVDVD 137 HSVDA V+GLPE GEF +EE E + A +KA+FV+RH+WKWV D Sbjct: 229 HSVDAFVDGLPEEGEFCTEEAEEYADSSAADKALFVKRHYWKWVSSD 275 >ref|XP_006441258.1| hypothetical protein CICLE_v10021557mg [Citrus clementina] gi|557543520|gb|ESR54498.1| hypothetical protein CICLE_v10021557mg [Citrus clementina] Length = 281 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 2/43 (4%) Frame = +3 Query: 3 HSVDAEVEGLPEVGEFSSEENGEGVE--AVEKAVFVRRHFWKW 125 HSVDA V+GLPE GEF +EE E + A +KA+FV+RH+WKW Sbjct: 229 HSVDAFVDGLPEEGEFCTEEAEEYADSSAADKALFVKRHYWKW 271