BLASTX nr result
ID: Zingiber23_contig00046469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00046469 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494620.1| PREDICTED: uncharacterized protein LOC102631... 58 1e-06 ref|XP_006432358.1| hypothetical protein CICLE_v10000575mg [Citr... 58 1e-06 >ref|XP_006494620.1| PREDICTED: uncharacterized protein LOC102631456 [Citrus sinensis] Length = 632 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/57 (54%), Positives = 37/57 (64%) Frame = +1 Query: 166 MSSASKAKLIDKLSAKAVKGQDKVSLKASAIPNHGNDVPSNVYNPDSGTFHNIDTTS 336 MS ASK+K K S KA K Q K +K S N GN VP++ YNP SGTFH +DT+S Sbjct: 1 MSPASKSK--SKPSGKASKEQQKAPIKPSGSANAGNGVPASAYNPISGTFHTLDTSS 55 >ref|XP_006432358.1| hypothetical protein CICLE_v10000575mg [Citrus clementina] gi|557534480|gb|ESR45598.1| hypothetical protein CICLE_v10000575mg [Citrus clementina] Length = 632 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/57 (54%), Positives = 37/57 (64%) Frame = +1 Query: 166 MSSASKAKLIDKLSAKAVKGQDKVSLKASAIPNHGNDVPSNVYNPDSGTFHNIDTTS 336 MS ASK+K K S KA K Q K +K S N GN VP++ YNP SGTFH +DT+S Sbjct: 1 MSPASKSK--SKPSGKASKEQQKAPIKPSGSANAGNGVPASAYNPISGTFHTLDTSS 55