BLASTX nr result
ID: Zingiber23_contig00046424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00046424 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 >ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 828 Score = 55.1 bits (131), Expect = 1e-05 Identities = 34/87 (39%), Positives = 48/87 (55%) Frame = -1 Query: 313 ISSCMLTAVESLFQRSLPSLSPTRQAHAGLLKCGLVPGDARHTSKLLAFYAGHRCVADVE 134 + S M + SL RS SLS T+Q HA +LK G D T+K+L+ YA C A+ E Sbjct: 81 LDSLMPNTILSLIARS-SSLSQTQQVHAHILKTGH-SSDTHFTNKVLSLYANFNCFANAE 138 Query: 133 FLSRSVTRPDPFAFSGVISVLVRSHLF 53 L S+ P+ F+F +I +S+LF Sbjct: 139 SLLHSLPNPNIFSFKSLIHASSKSNLF 165