BLASTX nr result
ID: Zingiber23_contig00045472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00045472 (492 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002451026.1| hypothetical protein SORBIDRAFT_05g022870 [S... 57 3e-06 >ref|XP_002451026.1| hypothetical protein SORBIDRAFT_05g022870 [Sorghum bicolor] gi|241936869|gb|EES10014.1| hypothetical protein SORBIDRAFT_05g022870 [Sorghum bicolor] Length = 777 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/65 (50%), Positives = 39/65 (60%), Gaps = 5/65 (7%) Frame = +2 Query: 20 ADDVNVVTCMAARRDLEREDHDGWA-----RPSAEVAEAAIQIERRIFKDLVDGTICDLV 184 A D+N VTC A RRDL + W R AEVA+A +QIER +FKDLV TI +L Sbjct: 703 AADLNDVTCSAIRRDLAADGSGPWGCQQKQRHGAEVADAVLQIERLVFKDLVADTIRELA 762 Query: 185 DACPP 199 DA P Sbjct: 763 DADRP 767