BLASTX nr result
ID: Zingiber23_contig00045406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00045406 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA57157.1| TPA: putative bZIP transcription factor superfam... 59 9e-07 ref|NP_001183222.1| putative bZIP transcription factor superfami... 59 9e-07 ref|XP_002458665.1| hypothetical protein SORBIDRAFT_03g037740 [S... 55 7e-06 >tpg|DAA57157.1| TPA: putative bZIP transcription factor superfamily protein [Zea mays] Length = 298 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -3 Query: 154 GMAMATQGAGRAQQDAQSQSLSRQGLACNLTLDQVQDHLGGPLLSMNLEDL 2 G M + G A Q Q QSL+RQG NLTLD+VQ HLG PL SMNLE+L Sbjct: 14 GRGMGSSGGAGAAQRGQMQSLARQGSLYNLTLDEVQSHLGEPLHSMNLEEL 64 >ref|NP_001183222.1| putative bZIP transcription factor superfamily protein isoform 1 [Zea mays] gi|238010152|gb|ACR36111.1| unknown [Zea mays] gi|414880027|tpg|DAA57158.1| TPA: putative bZIP transcription factor superfamily protein isoform 1 [Zea mays] gi|414880028|tpg|DAA57159.1| TPA: putative bZIP transcription factor superfamily protein isoform 2 [Zea mays] Length = 333 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -3 Query: 154 GMAMATQGAGRAQQDAQSQSLSRQGLACNLTLDQVQDHLGGPLLSMNLEDL 2 G M + G A Q Q QSL+RQG NLTLD+VQ HLG PL SMNLE+L Sbjct: 14 GRGMGSSGGAGAAQRGQMQSLARQGSLYNLTLDEVQSHLGEPLHSMNLEEL 64 >ref|XP_002458665.1| hypothetical protein SORBIDRAFT_03g037740 [Sorghum bicolor] gi|241930640|gb|EES03785.1| hypothetical protein SORBIDRAFT_03g037740 [Sorghum bicolor] Length = 333 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 133 GAGRAQQDAQSQSLSRQGLACNLTLDQVQDHLGGPLLSMNLEDL 2 GAG AQ+ Q QSL+RQG NLTLD+VQ HLG PL SMNLE+L Sbjct: 22 GAGAAQR-GQMQSLARQGSLYNLTLDEVQSHLGEPLHSMNLEEL 64