BLASTX nr result
ID: Zingiber23_contig00045238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00045238 (280 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858345.1| hypothetical protein AMTR_s00064p00167250 [A... 59 5e-07 >ref|XP_006858345.1| hypothetical protein AMTR_s00064p00167250 [Amborella trichopoda] gi|548862452|gb|ERN19812.1| hypothetical protein AMTR_s00064p00167250 [Amborella trichopoda] Length = 1144 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/75 (46%), Positives = 44/75 (58%), Gaps = 1/75 (1%) Frame = +1 Query: 4 PFTSTMTMDEVSITSGLLDPKMDHVYGQAS-KAAEGGDENMSDLSGTLHLHSSNSTPNLM 180 P+ MDEVS + LDPK +H + S K EG DE+M+DL G +HL PN + Sbjct: 713 PYVPPEPMDEVSSSPAALDPKEEHSTVEMSGKDQEGLDESMTDLLG-IHLQPVEPVPNSL 771 Query: 181 DASMLEQPRDEGKVD 225 DASMLE RDE +D Sbjct: 772 DASMLEPQRDEQHID 786