BLASTX nr result
ID: Zingiber23_contig00045219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00045219 (450 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004977697.1| PREDICTED: serine/arginine repetitive matrix... 56 6e-06 >ref|XP_004977697.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Setaria italica] Length = 607 Score = 55.8 bits (133), Expect = 6e-06 Identities = 46/153 (30%), Positives = 74/153 (48%), Gaps = 6/153 (3%) Frame = -2 Query: 449 RLMGLETSPPEKPLARKCPWESENKGIKAAVVXXXXXXXXXXXPLQTLSCNVDLGTRSLP 270 RLMG++ P++P P + + K + PL++LSCNV+ RSLP Sbjct: 137 RLMGID-GLPDQPSPSSAPGSGKGEKKKRVI----PESMNRREPLRSLSCNVE--ARSLP 189 Query: 269 ESPRASTSARAVDADRRLSLQ------INRLCQATYFDHSKSPKNKGHNLGKLYRDENKS 108 ++PR STSARA RLSLQ ++R Q S + GK + E + Sbjct: 190 DTPRGSTSARASWDGPRLSLQALKESVLDRAAQYMSMPSSPTSSAAAAAAGKKKKKERER 249 Query: 107 PRNHHHSREMVKRVVKEIKLNETKASASLTEKK 9 H+RE++++ + + ++K+S+ EKK Sbjct: 250 AAK-EHAREILRQAKENVATRKSKSSSPAAEKK 281