BLASTX nr result
ID: Zingiber23_contig00044781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00044781 (392 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN88198.1| retropepsin-like protein [Phaseolus vulgaris] 56 6e-06 >gb|AFN88198.1| retropepsin-like protein [Phaseolus vulgaris] Length = 725 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/61 (50%), Positives = 40/61 (65%) Frame = -2 Query: 184 KSGNAGFQNSEQSIPLPFPQRKVQPRKNVEEEKAKEFQELVDLFSKVEVNVPLLTMIKQI 5 + GNA SIPLPFPQR VQ + +E K +E+++ F KVEVN+PLL +IKQI Sbjct: 432 QGGNASLDRP--SIPLPFPQRVVQTSRKME----KTDKEILETFRKVEVNIPLLDVIKQI 485 Query: 4 P 2 P Sbjct: 486 P 486