BLASTX nr result
ID: Zingiber23_contig00044526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00044526 (232 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 66 6e-09 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 65.9 bits (159), Expect = 6e-09 Identities = 36/55 (65%), Positives = 40/55 (72%), Gaps = 2/55 (3%) Frame = -3 Query: 161 NLGLRCHDIVLWKRAG--EVRPGFFHC*LFKGGTFLTHILSYRHGPTDLFSISAS 3 +LGLRCHD + G EVRPGFF + +G TFLTHI SYRHGPTDLFSI AS Sbjct: 103 HLGLRCHDYFSMEAGGLLEVRPGFFGV-VGEGLTFLTHIHSYRHGPTDLFSIGAS 156