BLASTX nr result
ID: Zingiber23_contig00043913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00043913 (265 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006436789.1| hypothetical protein CICLE_v10031120mg [Citr... 70 3e-10 ref|XP_002527635.1| transcription factor, putative [Ricinus comm... 70 3e-10 gb|EMJ11101.1| hypothetical protein PRUPE_ppa004161mg [Prunus pe... 69 5e-10 ref|XP_004508999.1| PREDICTED: two-component response regulator-... 69 7e-10 ref|XP_003611439.1| Two-component response regulator-like protei... 68 1e-09 ref|XP_003611440.1| Two-component response regulator-like protei... 68 1e-09 ref|XP_006579674.1| PREDICTED: two-component response regulator-... 68 1e-09 ref|XP_006579673.1| PREDICTED: two-component response regulator-... 68 1e-09 ref|XP_006579672.1| PREDICTED: two-component response regulator-... 68 1e-09 ref|XP_006590603.1| PREDICTED: two-component response regulator-... 67 2e-09 ref|XP_003538769.1| PREDICTED: two-component response regulator-... 67 2e-09 gb|EOY24080.1| CheY-like two-component responsive regulator fami... 67 2e-09 gb|EOY24079.1| CheY-like two-component responsive regulator fami... 67 2e-09 ref|XP_003550939.1| PREDICTED: two-component response regulator-... 67 2e-09 ref|XP_002329584.1| pseudo response regulator [Populus trichocar... 66 6e-09 ref|XP_002329583.1| predicted protein [Populus trichocarpa] gi|5... 66 6e-09 gb|ESW27744.1| hypothetical protein PHAVU_003G228600g [Phaseolus... 65 7e-09 ref|XP_006368450.1| hypothetical protein POPTR_0001s02910g [Popu... 65 7e-09 ref|XP_006368449.1| hypothetical protein POPTR_0001s02910g [Popu... 65 7e-09 ref|XP_006368446.1| hypothetical protein POPTR_0001s02910g [Popu... 65 7e-09 >ref|XP_006436789.1| hypothetical protein CICLE_v10031120mg [Citrus clementina] gi|568864005|ref|XP_006485404.1| PREDICTED: two-component response regulator-like APRR2-like isoform X1 [Citrus sinensis] gi|568864007|ref|XP_006485405.1| PREDICTED: two-component response regulator-like APRR2-like isoform X2 [Citrus sinensis] gi|557538985|gb|ESR50029.1| hypothetical protein CICLE_v10031120mg [Citrus clementina] Length = 559 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A D AWKDFPKGL+V+LL++D S+A E K KLEAMDY VS F+NE + Sbjct: 1 MVCTANDLSAWKDFPKGLRVLLLDQDSSAAAELKFKLEAMDYIVSTFYNENE 52 >ref|XP_002527635.1| transcription factor, putative [Ricinus communis] gi|223532940|gb|EEF34706.1| transcription factor, putative [Ricinus communis] Length = 478 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A + AWKDFPKGL+V+LLE+D SA E KSKLEAMDY VSLF NE + Sbjct: 1 MVCTANELSAWKDFPKGLRVLLLEEDSISAEEIKSKLEAMDYIVSLFCNENE 52 >gb|EMJ11101.1| hypothetical protein PRUPE_ppa004161mg [Prunus persica] Length = 526 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A D WKDFPKGLKV+LL++D SSA E KSKLEAMDY V+ F NE + Sbjct: 1 MVCTANDLQEWKDFPKGLKVLLLDEDNSSAAEIKSKLEAMDYIVTTFCNETE 52 >ref|XP_004508999.1| PREDICTED: two-component response regulator-like APRR2-like isoform X1 [Cicer arietinum] gi|502152596|ref|XP_004509000.1| PREDICTED: two-component response regulator-like APRR2-like isoform X2 [Cicer arietinum] Length = 549 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A D WKDFPKGLKV+LLE D +SA ET++KLEAMDY VS F +E + Sbjct: 1 MVCTANDLQQWKDFPKGLKVLLLEGDNASAAETRAKLEAMDYNVSTFCDENE 52 >ref|XP_003611439.1| Two-component response regulator-like protein [Medicago truncatula] gi|355512774|gb|AES94397.1| Two-component response regulator-like protein [Medicago truncatula] Length = 543 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A D WKDFPKGL+V+LLE D +SA E ++KLE+MDY VS F+NE + Sbjct: 1 MVCTANDLQGWKDFPKGLRVLLLEGDNNSASEIRTKLESMDYNVSTFYNENE 52 >ref|XP_003611440.1| Two-component response regulator-like protein [Medicago truncatula] gi|355512775|gb|AES94398.1| Two-component response regulator-like protein [Medicago truncatula] Length = 548 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A D WKDFPKGL+V+LLE D +SA E ++KLE+MDY VS F+NE + Sbjct: 1 MVCTANDLQGWKDFPKGLRVLLLEGDNNSASEIRTKLESMDYNVSTFYNENE 52 >ref|XP_006579674.1| PREDICTED: two-component response regulator-like APRR2-like isoform X3 [Glycine max] Length = 520 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV SA D WKDFPKGLKV+LLE+D SA E ++KLEAMDY VS F E + Sbjct: 1 MVFSANDLQEWKDFPKGLKVLLLERDNISAAEIRAKLEAMDYNVSTFCEENE 52 >ref|XP_006579673.1| PREDICTED: two-component response regulator-like APRR2-like isoform X2 [Glycine max] Length = 553 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV SA D WKDFPKGLKV+LLE+D SA E ++KLEAMDY VS F E + Sbjct: 1 MVFSANDLQEWKDFPKGLKVLLLERDNISAAEIRAKLEAMDYNVSTFCEENE 52 >ref|XP_006579672.1| PREDICTED: two-component response regulator-like APRR2-like isoform X1 [Glycine max] Length = 571 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV SA D WKDFPKGLKV+LLE+D SA E ++KLEAMDY VS F E + Sbjct: 1 MVFSANDLQEWKDFPKGLKVLLLERDNISAAEIRAKLEAMDYNVSTFCEENE 52 >ref|XP_006590603.1| PREDICTED: two-component response regulator-like APRR2-like isoform X3 [Glycine max] Length = 568 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A D WKDFPKGL+V+LLE D SSA E + +LEAMDY+VS F++E + Sbjct: 1 MVCTANDLQGWKDFPKGLRVLLLEGDSSSAAEIREQLEAMDYKVSTFYDENE 52 >ref|XP_003538769.1| PREDICTED: two-component response regulator-like APRR2-like isoform X1 [Glycine max] gi|571487233|ref|XP_006590602.1| PREDICTED: two-component response regulator-like APRR2-like isoform X2 [Glycine max] Length = 570 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A D WKDFPKGL+V+LLE D SSA E + +LEAMDY+VS F++E + Sbjct: 1 MVCTANDLQGWKDFPKGLRVLLLEGDSSSAAEIREQLEAMDYKVSTFYDENE 52 >gb|EOY24080.1| CheY-like two-component responsive regulator family protein isoform 2 [Theobroma cacao] Length = 510 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A D AWKDFPKGL+V+LL++D +SA E +SKLEAMDY V F NE + Sbjct: 1 MVCTANDLSAWKDFPKGLRVLLLDEDSNSAAEIRSKLEAMDYIVYTFCNENE 52 >gb|EOY24079.1| CheY-like two-component responsive regulator family protein isoform 1 [Theobroma cacao] gi|508776825|gb|EOY24081.1| CheY-like two-component responsive regulator family protein isoform 1 [Theobroma cacao] Length = 556 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A D AWKDFPKGL+V+LL++D +SA E +SKLEAMDY V F NE + Sbjct: 1 MVCTANDLSAWKDFPKGLRVLLLDEDSNSAAEIRSKLEAMDYIVYTFCNENE 52 >ref|XP_003550939.1| PREDICTED: two-component response regulator-like APRR2-like [Glycine max] Length = 576 Score = 67.0 bits (162), Expect = 2e-09 Identities = 35/60 (58%), Positives = 41/60 (68%) Frame = +1 Query: 85 LRNVE*LEMVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 LRN MV +A D WKDFPKGLKV+L E+D SA E ++KLEAMDY VS F +E D Sbjct: 16 LRNDAKPAMVFTANDLQEWKDFPKGLKVLLHERDNISAAEIRAKLEAMDYNVSTFCDEND 75 >ref|XP_002329584.1| pseudo response regulator [Populus trichocarpa] gi|566161615|ref|XP_006385610.1| hypothetical protein POPTR_0003s08600g [Populus trichocarpa] gi|550342739|gb|ERP63407.1| hypothetical protein POPTR_0003s08600g [Populus trichocarpa] Length = 420 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV + D AWKDFPKGL V+LL++D SSA E KSKLEA+DY V F NE + Sbjct: 1 MVCTTNDLSAWKDFPKGLSVLLLDEDNSSAAEIKSKLEALDYIVYTFCNENE 52 >ref|XP_002329583.1| predicted protein [Populus trichocarpa] gi|566161617|ref|XP_006385611.1| hypothetical protein POPTR_0003s08600g [Populus trichocarpa] gi|550342740|gb|ERP63408.1| hypothetical protein POPTR_0003s08600g [Populus trichocarpa] Length = 549 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV + D AWKDFPKGL V+LL++D SSA E KSKLEA+DY V F NE + Sbjct: 1 MVCTTNDLSAWKDFPKGLSVLLLDEDNSSAAEIKSKLEALDYIVYTFCNENE 52 >gb|ESW27744.1| hypothetical protein PHAVU_003G228600g [Phaseolus vulgaris] Length = 559 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV +A D WKDFPKGLKV+LLE D SA E ++KLEAMDY VS F +E + Sbjct: 1 MVFTANDLQEWKDFPKGLKVLLLEGDSISAAEIRAKLEAMDYNVSTFCDENE 52 >ref|XP_006368450.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346364|gb|ERP65019.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] Length = 537 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV + D AWKDFPKGL+V+LL++D SA E KSKLEAMDY V F NE + Sbjct: 1 MVCTTNDLSAWKDFPKGLRVLLLDEDSMSAAEIKSKLEAMDYIVYTFCNETE 52 >ref|XP_006368449.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346363|gb|ERP65018.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] Length = 500 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV + D AWKDFPKGL+V+LL++D SA E KSKLEAMDY V F NE + Sbjct: 1 MVCTTNDLSAWKDFPKGLRVLLLDEDSMSAAEIKSKLEAMDYIVYTFCNETE 52 >ref|XP_006368446.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|566146887|ref|XP_006368447.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|566146889|ref|XP_006368448.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346360|gb|ERP65015.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346361|gb|ERP65016.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346362|gb|ERP65017.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] Length = 463 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +1 Query: 109 MVRSAEDFLAWKDFPKGLKVMLLEKDESSALETKSKLEAMDYEVSLFHNEED 264 MV + D AWKDFPKGL+V+LL++D SA E KSKLEAMDY V F NE + Sbjct: 1 MVCTTNDLSAWKDFPKGLRVLLLDEDSMSAAEIKSKLEAMDYIVYTFCNETE 52