BLASTX nr result
ID: Zingiber23_contig00043860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00043860 (371 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB28821.1| hypothetical protein L484_000744 [Morus notabilis... 55 1e-05 gb|EMJ04034.1| hypothetical protein PRUPE_ppa014511mg [Prunus pe... 55 1e-05 >gb|EXB28821.1| hypothetical protein L484_000744 [Morus notabilis] gi|587856311|gb|EXB46300.1| hypothetical protein L484_002386 [Morus notabilis] Length = 66 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 102 YVPPIRSLNLFVETVEAFLAEVAVFSMRAYPRIR 1 YVPPIRSLNLFVETVE + AV+++RAYPRIR Sbjct: 18 YVPPIRSLNLFVETVEDLFRQTAVYTLRAYPRIR 51 >gb|EMJ04034.1| hypothetical protein PRUPE_ppa014511mg [Prunus persica] Length = 66 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 102 YVPPIRSLNLFVETVEAFLAEVAVFSMRAYPRIR 1 YVPPIRS+NLFVET+E FL AV+S+R YPR+R Sbjct: 18 YVPPIRSINLFVETIEDFLRNTAVYSIRLYPRLR 51