BLASTX nr result
ID: Zingiber23_contig00043706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00043706 (238 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844230.1| hypothetical protein AMTR_s00006p00267510 [A... 59 7e-07 gb|EMJ18334.1| hypothetical protein PRUPE_ppa000046mg [Prunus pe... 59 9e-07 >ref|XP_006844230.1| hypothetical protein AMTR_s00006p00267510 [Amborella trichopoda] gi|548846629|gb|ERN05905.1| hypothetical protein AMTR_s00006p00267510 [Amborella trichopoda] Length = 2271 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/59 (44%), Positives = 37/59 (62%) Frame = +2 Query: 2 CHQTFSTEVELDGHNDGRCTPNNTGSDESKESNDQSKVKGIRSENVRGKENHEEIDVGD 178 CH+TF T +EL+GH+DGRC + DESKE++D K K E+ R ++E DV + Sbjct: 1932 CHKTFCTHLELEGHDDGRCNSSVPVPDESKENDDPCKAKRTGHESTRQNNGNDEADVSE 1990 >gb|EMJ18334.1| hypothetical protein PRUPE_ppa000046mg [Prunus persica] Length = 2154 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 5/59 (8%) Frame = +2 Query: 2 CHQTFSTEVELDGHNDGRCTPNNTGSDESKESNDQSKVKG-----IRSENVRGKENHEE 163 CH+TF + EL+GHNDGRC P + ++ KE +D SKVKG I E RG+ N E Sbjct: 1787 CHRTFVADAELEGHNDGRCVPFSAACEKGKEISDSSKVKGSLKCEINREECRGELNSVE 1845