BLASTX nr result
ID: Zingiber23_contig00043244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00043244 (229 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518977.1| transcription factor, putative [Ricinus comm... 55 7e-06 >ref|XP_002518977.1| transcription factor, putative [Ricinus communis] gi|223541964|gb|EEF43510.1| transcription factor, putative [Ricinus communis] Length = 780 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +1 Query: 64 MVEGRAFLSIEASNQLKILKQKKLEFYKETKAVQETVNATSAMSRSGGDALKTPA 228 MVEGR LS EA N L+ LK+K+L+ K ++ + ETV+ TS MSRSGGDAL+ A Sbjct: 1 MVEGRVCLSKEARNGLEFLKRKRLQRMK-SETLTETVSVTSTMSRSGGDALRASA 54