BLASTX nr result
ID: Zingiber23_contig00043228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00043228 (291 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADI18282.1| hypothetical protein [uncultured Chromatiales bac... 79 6e-13 ref|WP_005514638.1| hypothetical protein [Vibrio mimicus] gi|258... 65 9e-09 >gb|ADI18282.1| hypothetical protein [uncultured Chromatiales bacterium HF0200_41F04] Length = 89 Score = 79.0 bits (193), Expect = 6e-13 Identities = 48/84 (57%), Positives = 52/84 (61%), Gaps = 2/84 (2%) Frame = +2 Query: 2 SRVLSNALGYSPRPPVSVWGTDSFCLKLRDFSWKHGINHFVSKE-TRHHASDNHSG-FA* 175 +RVLS+ALGYSP PPVSVWGT +F LKLR FSWK GINHF K+ RH S S F Sbjct: 6 TRVLSSALGYSPCPPVSVWGTVTFYLKLRGFSWKQGINHFGPKKGPRHRISGLLSRIFLR 65 Query: 176 SALLCA*TTIQQVAGLTFSVLPSQ 247 C A LTFSV PSQ Sbjct: 66 ELPTCLNRDNHHPADLTFSVTPSQ 89 >ref|WP_005514638.1| hypothetical protein [Vibrio mimicus] gi|258583990|gb|EEW08769.1| hypothetical protein VMD_37440 [Vibrio mimicus VM573] Length = 104 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = +2 Query: 2 SRVLSNALGYSPRPPVSVWGTDSFCLKLRDFSWKHGINHFVSKETRHHAS 151 +RVLS+AL +S RPPVSVWGT + LKLR FSWKHGIN F + R S Sbjct: 47 TRVLSSALVFSTRPPVSVWGTIPYNLKLRGFSWKHGINDFTTVVARRRVS 96