BLASTX nr result
ID: Zingiber23_contig00043122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00043122 (217 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858345.1| hypothetical protein AMTR_s00064p00167250 [A... 55 1e-05 >ref|XP_006858345.1| hypothetical protein AMTR_s00064p00167250 [Amborella trichopoda] gi|548862452|gb|ERN19812.1| hypothetical protein AMTR_s00064p00167250 [Amborella trichopoda] Length = 1144 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/73 (43%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = +1 Query: 1 IFGEGDARIPYMLTMPMDEVSSTSGLLDPKMEHVYAQAS-KATEGGDENMSDLSGMLNLH 177 + G+ + PY+ PMDEVSS+ LDPK EH + S K EG DE+M+DL G ++L Sbjct: 704 VCGDAEVHAPYVPPEPMDEVSSSPAALDPKEEHSTVEMSGKDQEGLDESMTDLLG-IHLQ 762 Query: 178 AVKSTHNLMDDSM 216 V+ N +D SM Sbjct: 763 PVEPVPNSLDASM 775