BLASTX nr result
ID: Zingiber23_contig00043040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00043040 (225 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT05005.1| Eukaryotic translation initiation factor 5B [Aegi... 55 1e-05 gb|EMS52752.1| Eukaryotic translation initiation factor 5B [Trit... 55 1e-05 >gb|EMT05005.1| Eukaryotic translation initiation factor 5B [Aegilops tauschii] Length = 1152 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = +3 Query: 6 QKKKKKGGRSAREEEDLVKLLADLGEAPAPGPSESQMVDEDNVPGAELSEQAIISEVADT 185 +KKKKK GR+A+EEEDL KLLA+LGE PAP P E P L + + E A+T Sbjct: 125 KKKKKKSGRTAQEEEDLDKLLAELGEGPAPAP-------EKEKPSQALPSASAVKEDAET 177 >gb|EMS52752.1| Eukaryotic translation initiation factor 5B [Triticum urartu] Length = 1092 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = +3 Query: 6 QKKKKKGGRSAREEEDLVKLLADLGEAPAPGPSESQMVDEDNVPGAELSEQAIISEVADT 185 +KKKKK GR+A+EEEDL KLLA+LGE PAP P E P L + + E A+T Sbjct: 125 KKKKKKSGRTAQEEEDLDKLLAELGEGPAPAP-------EKEKPSQALPSASAVKEDAET 177