BLASTX nr result
ID: Zingiber23_contig00043022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00043022 (280 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW70412.1| putative autophagy domain family protein [Zea mays] 56 6e-06 >gb|AFW70412.1| putative autophagy domain family protein [Zea mays] Length = 1143 Score = 55.8 bits (133), Expect = 6e-06 Identities = 38/87 (43%), Positives = 47/87 (54%), Gaps = 1/87 (1%) Frame = +1 Query: 13 STMMMDEVSITSGLLDPKMDHVFGQASKAAEGGDENMSDLSGTLNLHAINSTH-NLMDAS 189 S++ MDE S TS Q SK AEGGDENM+D+SG LNL ++S +DA Sbjct: 726 SSVAMDEASSTSE-----------QPSKQAEGGDENMTDISGALNLQLLDSAACTNLDAF 774 Query: 190 MLEQPRDEGKVDPLVDAVKMMTSQLTM 270 M E PRD +D M +QLTM Sbjct: 775 MTELPRDNEHKIVNIDKEGHMLTQLTM 801