BLASTX nr result
ID: Zingiber23_contig00042900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00042900 (271 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004957985.1| PREDICTED: eukaryotic translation initiation... 55 7e-06 >ref|XP_004957985.1| PREDICTED: eukaryotic translation initiation factor 4G-like [Setaria italica] Length = 1791 Score = 55.5 bits (132), Expect = 7e-06 Identities = 39/81 (48%), Positives = 48/81 (59%), Gaps = 7/81 (8%) Frame = -3 Query: 266 KSPLQSPRRINDRPSSRGDCRPVGLLDDDKWTKSHA--SFGRD-----GNATINLRPGQG 108 + P SP R +DRP+SRGD R + DD+WTKS S GRD G + +N R G G Sbjct: 1059 REPHPSPGRGSDRPTSRGDRRGAAMA-DDRWTKSGVPLSPGRDMDLANGPSIVNYRGGPG 1117 Query: 107 GSHVVLRDLPRQASGQLGGIL 45 GSH VLR+ PR G GG+L Sbjct: 1118 GSHGVLRN-PRGQPG--GGLL 1135