BLASTX nr result
ID: Zingiber23_contig00042884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00042884 (202 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002443190.1| hypothetical protein SORBIDRAFT_08g014900 [S... 91 1e-16 ref|NP_001168064.1| hypothetical protein [Zea mays] gi|223945795... 89 8e-16 ref|XP_006856239.1| hypothetical protein AMTR_s00059p00214190 [A... 86 4e-15 ref|XP_004962675.1| PREDICTED: lysine histidine transporter-like... 86 7e-15 ref|XP_003576214.1| PREDICTED: lysine histidine transporter-like... 85 9e-15 ref|XP_002284114.1| PREDICTED: lysine histidine transporter-like... 85 9e-15 emb|CAN78281.1| hypothetical protein VITISV_021650 [Vitis vinifera] 85 9e-15 ref|XP_002327101.1| lysine/histidine transporter [Populus tricho... 84 1e-14 gb|EXB38623.1| hypothetical protein L484_014437 [Morus notabilis] 84 2e-14 ref|XP_002973454.1| hypothetical protein SELMODRAFT_99162 [Selag... 84 2e-14 ref|XP_002993599.1| hypothetical protein SELMODRAFT_236771 [Sela... 84 2e-14 ref|XP_004291933.1| PREDICTED: lysine histidine transporter-like... 84 3e-14 ref|XP_006354939.1| PREDICTED: lysine histidine transporter-like... 83 3e-14 ref|XP_004238196.1| PREDICTED: lysine histidine transporter-like... 83 3e-14 ref|XP_002510286.1| amino acid transporter, putative [Ricinus co... 83 3e-14 ref|XP_006664563.1| PREDICTED: lysine histidine transporter-like... 83 4e-14 gb|EOY14612.1| Transmembrane amino acid transporter family prote... 83 4e-14 gb|EOY14611.1| Transmembrane amino acid transporter family prote... 83 4e-14 ref|XP_004485720.1| PREDICTED: lysine histidine transporter-like... 83 4e-14 ref|XP_004141237.1| PREDICTED: lysine histidine transporter-like... 83 4e-14 >ref|XP_002443190.1| hypothetical protein SORBIDRAFT_08g014900 [Sorghum bicolor] gi|241943883|gb|EES17028.1| hypothetical protein SORBIDRAFT_08g014900 [Sorghum bicolor] Length = 513 Score = 91.3 bits (225), Expect = 1e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMWIR+KKP+RFSFSWYLNW LGLLG AFS+ FS+GG+WS+ Sbjct: 455 AYPCFMWIRVKKPERFSFSWYLNWGLGLLGTAFSLAFSLGGIWSI 499 >ref|NP_001168064.1| hypothetical protein [Zea mays] gi|223945795|gb|ACN26981.1| unknown [Zea mays] gi|414877750|tpg|DAA54881.1| TPA: hypothetical protein ZEAMMB73_506091 [Zea mays] Length = 508 Score = 88.6 bits (218), Expect = 8e-16 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMWI +KKP+RFSFSWYLNW LGLLG AFS+ FS+GGVWS+ Sbjct: 451 AYPCFMWICVKKPERFSFSWYLNWGLGLLGTAFSLAFSLGGVWSI 495 >ref|XP_006856239.1| hypothetical protein AMTR_s00059p00214190 [Amborella trichopoda] gi|548860098|gb|ERN17706.1| hypothetical protein AMTR_s00059p00214190 [Amborella trichopoda] Length = 547 Score = 86.3 bits (212), Expect = 4e-15 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IK+P RFSFSWYLNW+LG+LGIAFS+ S GGVWSM Sbjct: 490 AYPCFMWVLIKRPTRFSFSWYLNWTLGILGIAFSMALSAGGVWSM 534 >ref|XP_004962675.1| PREDICTED: lysine histidine transporter-like 8-like [Setaria italica] Length = 512 Score = 85.5 bits (210), Expect = 7e-15 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMWIR+KKP+R SFSWYLNW L LLG AFS+ FS+GGVW + Sbjct: 454 AYPCFMWIRVKKPERLSFSWYLNWGLALLGTAFSLAFSLGGVWGI 498 >ref|XP_003576214.1| PREDICTED: lysine histidine transporter-like 8-like [Brachypodium distachyon] Length = 506 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMWI IKKP+RFSFSWYLNW L LLG AFSV S+GGVWS+ Sbjct: 449 AYPCFMWICIKKPERFSFSWYLNWGLALLGTAFSVASSVGGVWSI 493 >ref|XP_002284114.1| PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera] gi|302142384|emb|CBI19587.3| unnamed protein product [Vitis vinifera] Length = 514 Score = 85.1 bits (209), Expect = 9e-15 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IKKP +FSF+WY NW LG LGIAFS+ FSIGGVWSM Sbjct: 457 AYPCFMWVLIKKPTKFSFNWYFNWILGWLGIAFSLAFSIGGVWSM 501 >emb|CAN78281.1| hypothetical protein VITISV_021650 [Vitis vinifera] Length = 493 Score = 85.1 bits (209), Expect = 9e-15 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IKKP +FSF+WY NW LG LGIAFS+ FSIGGVWSM Sbjct: 436 AYPCFMWVLIKKPTKFSFNWYFNWILGWLGIAFSLAFSIGGVWSM 480 >ref|XP_002327101.1| lysine/histidine transporter [Populus trichocarpa] gi|566202279|ref|XP_006375013.1| amino acid transporter family protein [Populus trichocarpa] gi|550323327|gb|ERP52810.1| amino acid transporter family protein [Populus trichocarpa] Length = 521 Score = 84.3 bits (207), Expect = 1e-14 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IKKP ++SF+WY NW LG LGIAFS+ FSIGGVWSM Sbjct: 463 AYPCFMWVLIKKPSKYSFNWYFNWILGWLGIAFSLAFSIGGVWSM 507 >gb|EXB38623.1| hypothetical protein L484_014437 [Morus notabilis] Length = 521 Score = 84.0 bits (206), Expect = 2e-14 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IKKP ++SF+WY NW LG LGIAFS+ FSIGGVWSM Sbjct: 464 AYPCFMWVLIKKPTKYSFNWYFNWILGWLGIAFSLAFSIGGVWSM 508 >ref|XP_002973454.1| hypothetical protein SELMODRAFT_99162 [Selaginella moellendorffii] gi|300159207|gb|EFJ25828.1| hypothetical protein SELMODRAFT_99162 [Selaginella moellendorffii] Length = 507 Score = 84.0 bits (206), Expect = 2e-14 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = +3 Query: 69 YPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 YPCFMW++IKKP RFSF+WYLNW+LG+LGI FS+ F+ GG+WS+ Sbjct: 452 YPCFMWLKIKKPPRFSFTWYLNWTLGILGIVFSITFTAGGIWSI 495 >ref|XP_002993599.1| hypothetical protein SELMODRAFT_236771 [Selaginella moellendorffii] gi|300138527|gb|EFJ05291.1| hypothetical protein SELMODRAFT_236771 [Selaginella moellendorffii] Length = 456 Score = 84.0 bits (206), Expect = 2e-14 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = +3 Query: 69 YPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 YPCFMW++IKKP RFSF+WYLNW+LG+LGI FS+ F+ GG+WS+ Sbjct: 401 YPCFMWLKIKKPPRFSFTWYLNWTLGILGIVFSITFTAGGIWSI 444 >ref|XP_004291933.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria vesca subsp. vesca] Length = 521 Score = 83.6 bits (205), Expect = 3e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IKKP ++SF+WY NW LG LGIAFS+ FSIGG+WSM Sbjct: 463 AYPCFMWVLIKKPTKYSFNWYFNWILGWLGIAFSLAFSIGGIWSM 507 >ref|XP_006354939.1| PREDICTED: lysine histidine transporter-like 8-like [Solanum tuberosum] Length = 525 Score = 83.2 bits (204), Expect = 3e-14 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IKKP ++SF+WY NW LG LG+AFS+ FSIGG+WSM Sbjct: 468 AYPCFMWVLIKKPTKYSFNWYFNWILGWLGVAFSLAFSIGGIWSM 512 >ref|XP_004238196.1| PREDICTED: lysine histidine transporter-like 8-like [Solanum lycopersicum] Length = 525 Score = 83.2 bits (204), Expect = 3e-14 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IKKP ++SF+WY NW LG LG+AFS+ FSIGG+WSM Sbjct: 468 AYPCFMWVLIKKPTKYSFNWYFNWILGWLGVAFSLAFSIGGIWSM 512 >ref|XP_002510286.1| amino acid transporter, putative [Ricinus communis] gi|223550987|gb|EEF52473.1| amino acid transporter, putative [Ricinus communis] Length = 521 Score = 83.2 bits (204), Expect = 3e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IK+P ++SF+WY NW LG LGIAFS+ FSIGGVWSM Sbjct: 463 AYPCFMWVLIKRPSKYSFNWYFNWILGWLGIAFSLAFSIGGVWSM 507 >ref|XP_006664563.1| PREDICTED: lysine histidine transporter-like 8-like [Oryza brachyantha] Length = 507 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMWI IKKP+RFS WYLNW LGLLG AFS+ F +GGVWS+ Sbjct: 449 AYPCFMWICIKKPERFSSGWYLNWGLGLLGTAFSLAFCVGGVWSI 493 >gb|EOY14612.1| Transmembrane amino acid transporter family protein isoform 2 [Theobroma cacao] Length = 488 Score = 82.8 bits (203), Expect = 4e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IK+P ++SF+WY NW LG LGIAFS+ FSIGGVWSM Sbjct: 431 AYPCFMWVLIKRPTKYSFNWYFNWILGWLGIAFSLAFSIGGVWSM 475 >gb|EOY14611.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] Length = 520 Score = 82.8 bits (203), Expect = 4e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IK+P ++SF+WY NW LG LGIAFS+ FSIGGVWSM Sbjct: 463 AYPCFMWVLIKRPTKYSFNWYFNWILGWLGIAFSLAFSIGGVWSM 507 >ref|XP_004485720.1| PREDICTED: lysine histidine transporter-like 8-like [Cicer arietinum] Length = 520 Score = 82.8 bits (203), Expect = 4e-14 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IK+P ++SFSWY NW LG LG+AFS+ FSIGG+WSM Sbjct: 463 AYPCFMWVLIKQPTKYSFSWYFNWILGWLGVAFSLAFSIGGIWSM 507 >ref|XP_004141237.1| PREDICTED: lysine histidine transporter-like 8-like [Cucumis sativus] Length = 520 Score = 82.8 bits (203), Expect = 4e-14 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +3 Query: 66 AYPCFMWIRIKKPQRFSFSWYLNWSLGLLGIAFSVCFSIGGVWSM 200 AYPCFMW+ IKKP +FSF+WY +W+LG LGIAFS+ FSIGG+WS+ Sbjct: 463 AYPCFMWVLIKKPTKFSFNWYFHWTLGWLGIAFSLAFSIGGIWSL 507