BLASTX nr result
ID: Zingiber23_contig00042796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00042796 (533 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003567918.1| PREDICTED: cytochrome c oxidase assembly pro... 81 2e-13 ref|XP_004961253.1| PREDICTED: cytochrome c oxidase assembly pro... 80 4e-13 ref|XP_002468590.1| hypothetical protein SORBIDRAFT_01g048650 [S... 80 4e-13 gb|EEE56831.1| hypothetical protein OsJ_06434 [Oryza sativa Japo... 80 4e-13 gb|EEC73006.1| hypothetical protein OsI_06928 [Oryza sativa Indi... 80 4e-13 ref|NP_001046657.2| Os02g0313500 [Oryza sativa Japonica Group] g... 80 4e-13 gb|ACG38035.1| cytochrome c oxidase assembly protein COX19 [Zea ... 80 4e-13 gb|ACG25895.1| cytochrome c oxidase assembly protein COX19 [Zea ... 80 4e-13 ref|XP_002440230.1| hypothetical protein SORBIDRAFT_09g028140 [S... 79 8e-13 ref|XP_004985694.1| PREDICTED: cytochrome c oxidase assembly pro... 78 1e-12 gb|AFW79120.1| hypothetical protein ZEAMMB73_460562 [Zea mays] 78 1e-12 gb|ACG40852.1| cytochrome c oxidase assembly protein COX19 [Zea ... 78 1e-12 gb|EMT08547.1| hypothetical protein F775_27905 [Aegilops tauschii] 78 1e-12 dbj|BAK05956.1| predicted protein [Hordeum vulgare subsp. vulgare] 78 1e-12 ref|XP_002515994.1| Cytochrome c oxidase assembly protein COX19,... 78 1e-12 ref|XP_002299727.1| cox19 family protein [Populus trichocarpa] g... 78 1e-12 ref|XP_006465657.1| PREDICTED: cytochrome c oxidase assembly pro... 76 5e-12 ref|XP_006426909.1| hypothetical protein CICLE_v10026826mg [Citr... 76 5e-12 gb|EOY26880.1| Cytochrome c oxidase 19-1 isoform 2 [Theobroma ca... 76 5e-12 gb|EOY26879.1| Cytochrome c oxidase 19-1 isoform 1 [Theobroma ca... 76 5e-12 >ref|XP_003567918.1| PREDICTED: cytochrome c oxidase assembly protein COX19-like [Brachypodium distachyon] Length = 101 Score = 80.9 bits (198), Expect = 2e-13 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KKEY+ACLKS+G+QSEKC Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKEYLACLKSTGFQSEKC 52 >ref|XP_004961253.1| PREDICTED: cytochrome c oxidase assembly protein COX19-like [Setaria italica] Length = 106 Score = 79.7 bits (195), Expect = 4e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS+G+QSEKC Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKC 52 >ref|XP_002468590.1| hypothetical protein SORBIDRAFT_01g048650 [Sorghum bicolor] gi|241922444|gb|EER95588.1| hypothetical protein SORBIDRAFT_01g048650 [Sorghum bicolor] Length = 109 Score = 79.7 bits (195), Expect = 4e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS+G+QSEKC Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKC 52 >gb|EEE56831.1| hypothetical protein OsJ_06434 [Oryza sativa Japonica Group] Length = 185 Score = 79.7 bits (195), Expect = 4e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS+G+QSEKC Sbjct: 94 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKC 131 >gb|EEC73006.1| hypothetical protein OsI_06928 [Oryza sativa Indica Group] Length = 185 Score = 79.7 bits (195), Expect = 4e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS+G+QSEKC Sbjct: 94 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKC 131 >ref|NP_001046657.2| Os02g0313500 [Oryza sativa Japonica Group] gi|215767662|dbj|BAG99890.1| unnamed protein product [Oryza sativa Japonica Group] gi|255670833|dbj|BAF08571.2| Os02g0313500 [Oryza sativa Japonica Group] Length = 106 Score = 79.7 bits (195), Expect = 4e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS+G+QSEKC Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKC 52 >gb|ACG38035.1| cytochrome c oxidase assembly protein COX19 [Zea mays] gi|195652211|gb|ACG45573.1| cytochrome c oxidase assembly protein COX19 [Zea mays] Length = 109 Score = 79.7 bits (195), Expect = 4e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS+G+QSEKC Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKC 52 >gb|ACG25895.1| cytochrome c oxidase assembly protein COX19 [Zea mays] gi|195640054|gb|ACG39495.1| cytochrome c oxidase assembly protein COX19 [Zea mays] Length = 109 Score = 79.7 bits (195), Expect = 4e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS+G+QSEKC Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKC 52 >ref|XP_002440230.1| hypothetical protein SORBIDRAFT_09g028140 [Sorghum bicolor] gi|241945515|gb|EES18660.1| hypothetical protein SORBIDRAFT_09g028140 [Sorghum bicolor] Length = 99 Score = 78.6 bits (192), Expect = 8e-13 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y++CLKS+G+QSEKC Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLSCLKSTGFQSEKC 52 >ref|XP_004985694.1| PREDICTED: cytochrome c oxidase assembly protein COX19-like [Setaria italica] Length = 109 Score = 78.2 bits (191), Expect = 1e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECD KK+Y+ACLKS+G+QSEKC Sbjct: 15 PVPPEKGVFPLDHLHECDFEKKDYLACLKSTGFQSEKC 52 >gb|AFW79120.1| hypothetical protein ZEAMMB73_460562 [Zea mays] Length = 104 Score = 78.2 bits (191), Expect = 1e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ CLKS+G+QSEKC Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLGCLKSTGFQSEKC 52 >gb|ACG40852.1| cytochrome c oxidase assembly protein COX19 [Zea mays] Length = 104 Score = 78.2 bits (191), Expect = 1e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ CLKS+G+QSEKC Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLGCLKSTGFQSEKC 52 >gb|EMT08547.1| hypothetical protein F775_27905 [Aegilops tauschii] Length = 116 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS+G QSEKC Sbjct: 14 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGAQSEKC 51 >dbj|BAK05956.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 110 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS+G QSEKC Sbjct: 19 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGAQSEKC 56 >ref|XP_002515994.1| Cytochrome c oxidase assembly protein COX19, putative [Ricinus communis] gi|223544899|gb|EEF46414.1| Cytochrome c oxidase assembly protein COX19, putative [Ricinus communis] Length = 94 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKGIFPLDH+HECDL KK+Y+ CLKSSG+QSEKC Sbjct: 15 PVPPEKGIFPLDHMHECDLEKKDYLNCLKSSGHQSEKC 52 >ref|XP_002299727.1| cox19 family protein [Populus trichocarpa] gi|222846985|gb|EEE84532.1| cox19 family protein [Populus trichocarpa] Length = 98 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKGIFPLDH+HECDL KK+Y+ CLKSSG+QSEKC Sbjct: 15 PVPPEKGIFPLDHMHECDLEKKDYLNCLKSSGHQSEKC 52 >ref|XP_006465657.1| PREDICTED: cytochrome c oxidase assembly protein COX19-like [Citrus sinensis] Length = 100 Score = 75.9 bits (185), Expect = 5e-12 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDH+H+CDL KK+YI CLKSSG+QSE C Sbjct: 15 PVPPEKGVFPLDHMHQCDLEKKDYIGCLKSSGHQSENC 52 >ref|XP_006426909.1| hypothetical protein CICLE_v10026826mg [Citrus clementina] gi|557528899|gb|ESR40149.1| hypothetical protein CICLE_v10026826mg [Citrus clementina] Length = 100 Score = 75.9 bits (185), Expect = 5e-12 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKG+FPLDH+H+CDL KK+YI CLKSSG+QSE C Sbjct: 15 PVPPEKGVFPLDHMHQCDLEKKDYIGCLKSSGHQSENC 52 >gb|EOY26880.1| Cytochrome c oxidase 19-1 isoform 2 [Theobroma cacao] Length = 98 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKGIFPLDHLHECDL KKEY+ CLK+SG++S+KC Sbjct: 15 PVPPEKGIFPLDHLHECDLEKKEYLNCLKTSGHKSDKC 52 >gb|EOY26879.1| Cytochrome c oxidase 19-1 isoform 1 [Theobroma cacao] Length = 122 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 418 PVPPEKGIFPLDHLHECDLAKKEYIACLKSSGYQSEKC 531 PVPPEKGIFPLDHLHECDL KKEY+ CLK+SG++S+KC Sbjct: 39 PVPPEKGIFPLDHLHECDLEKKEYLNCLKTSGHKSDKC 76