BLASTX nr result
ID: Zingiber23_contig00042736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00042736 (333 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS67637.1| Neurofilament heavy polypeptide [Triticum urartu] 74 3e-11 gb|AGE46115.1| arginine/serine-rich splicing factor RS2Z34 trans... 69 5e-10 gb|AGE46057.1| arginine/serine-rich splicing factor RS2Z35 trans... 44 4e-08 gb|AGE46053.1| arginine/serine-rich splicing factor RS2Z37B tran... 51 6e-08 gb|AGE46119.1| arginine/serine-rich splicing factor RS2Z34 trans... 48 1e-06 emb|CBI32650.3| unnamed protein product [Vitis vinifera] 57 2e-06 >gb|EMS67637.1| Neurofilament heavy polypeptide [Triticum urartu] Length = 431 Score = 73.6 bits (179), Expect = 3e-11 Identities = 54/133 (40%), Positives = 62/133 (46%), Gaps = 23/133 (17%) Frame = -3 Query: 331 RLYVGRISHRTRARDLEDLFGRYGR------FLGFL------------AQPGGL----WW 218 RLYVGR+ RTR RDLEDLFGRYGR FL A P + WW Sbjct: 40 RLYVGRLPSRTRTRDLEDLFGRYGRAEIETHLFNFLHPMALVIDMVLGAYPTSVSMVDWW 99 Query: 217 EGAIGGFGVYPSKFIGDFGDSFSNVIDVC*WESSPSGV*LIF*GLK*CTFQYLSPDGL-L 41 EGA+GG G Y KFI L+ TF YL DG+ + Sbjct: 100 EGALGGIGGYSRKFI-----------------------------LRGDTFLYLRLDGVTV 130 Query: 40 SGNNFRRVRNVDM 2 SGN+F RVR+VDM Sbjct: 131 SGNHFHRVRHVDM 143 >gb|AGE46115.1| arginine/serine-rich splicing factor RS2Z34 transcript II [Sorghum bicolor] gi|448878306|gb|AGE46116.1| arginine/serine-rich splicing factor RS2Z34 transcript III [Sorghum bicolor] gi|448878308|gb|AGE46117.1| arginine/serine-rich splicing factor RS2Z34 transcript IV [Sorghum bicolor] Length = 94 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = -3 Query: 331 RLYVGRISHRTRARDLEDLFGRYGRFLGFLAQPGGLWWEGAIG 203 RLYVGR+S RTR RDLEDLFGRYGRF G L QP WWEGA+G Sbjct: 25 RLYVGRVSSRTRTRDLEDLFGRYGRFWG-LTQPRCPWWEGALG 66 >gb|AGE46057.1| arginine/serine-rich splicing factor RS2Z35 transcript II [Zea mays] Length = 73 Score = 43.9 bits (102), Expect(2) = 4e-08 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = -3 Query: 331 RLYVGRISHRTRARDLEDLFGRYGRFLGF 245 RLYVGR++ RTR+RDLE LF +YGRF F Sbjct: 12 RLYVGRLAPRTRSRDLEYLFSKYGRFSVF 40 Score = 39.3 bits (90), Expect(2) = 4e-08 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = -1 Query: 255 FWVFWPNLEVFGGRVPLVDLVSILP 181 F VF+P +EV GGRVPLV+LV+I+P Sbjct: 37 FSVFYPTMEVCGGRVPLVELVAIVP 61 >gb|AGE46053.1| arginine/serine-rich splicing factor RS2Z37B transcript II [Zea mays] gi|448878182|gb|AGE46054.1| arginine/serine-rich splicing factor RS2Z37B transcript III [Zea mays] Length = 58 Score = 50.8 bits (120), Expect(2) = 6e-08 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -3 Query: 331 RLYVGRISHRTRARDLEDLFGRYGRFLGFLAQPGG 227 RLYVGR++ RTR+RDLE LFG+YGRF GF + G Sbjct: 12 RLYVGRLAPRTRSRDLEYLFGKYGRFFGFYREVFG 46 Score = 31.6 bits (70), Expect(2) = 6e-08 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -1 Query: 231 EVFGGRVPLVDLVSI 187 EVFGGRVPLVDLV+I Sbjct: 43 EVFGGRVPLVDLVTI 57 >gb|AGE46119.1| arginine/serine-rich splicing factor RS2Z34 transcript VI [Sorghum bicolor] Length = 74 Score = 47.8 bits (112), Expect(2) = 1e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 331 RLYVGRISHRTRARDLEDLFGRYG 260 RLYVGR+S RTR RDLEDLFGRYG Sbjct: 25 RLYVGRVSSRTRTRDLEDLFGRYG 48 Score = 30.0 bits (66), Expect(2) = 1e-06 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 240 PNLEVFGGRVPLVDLVSILPSL 175 P V GGRVPLV L+++LP L Sbjct: 50 PTSGVHGGRVPLVQLLAVLPKL 71 >emb|CBI32650.3| unnamed protein product [Vitis vinifera] Length = 60 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -3 Query: 331 RLYVGRISHRTRARDLEDLFGRYGRFLGFLAQPGGLWWEGAIGGF 197 RLYVGR+S RTR RDLE LF RYGRFLGF L W +GG+ Sbjct: 12 RLYVGRLSSRTRTRDLESLFSRYGRFLGFC-----LTWRSMVGGW 51