BLASTX nr result
ID: Zingiber23_contig00042590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00042590 (232 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494504.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 gb|ESW35278.1| hypothetical protein PHAVU_001G221600g [Phaseolus... 71 2e-10 ref|XP_004163774.1| PREDICTED: putative pentatricopeptide repeat... 69 5e-10 ref|XP_002276220.2| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 emb|CAN76247.1| hypothetical protein VITISV_023383 [Vitis vinifera] 69 9e-10 gb|EOY11777.1| Tetratricopeptide repeat superfamily protein [The... 68 1e-09 ref|XP_003617808.1| Pentatricopeptide repeat-containing protein ... 67 2e-09 gb|EMT10341.1| hypothetical protein F775_06242 [Aegilops tauschii] 67 2e-09 ref|NP_196272.1| pentatricopeptide repeat-containing protein [Ar... 67 2e-09 ref|XP_004231338.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_003568436.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_004495951.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_004955182.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 gb|EMS64050.1| hypothetical protein TRIUR3_15300 [Triticum urartu] 65 9e-09 ref|XP_004141894.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 tpg|DAA57875.1| TPA: hypothetical protein ZEAMMB73_657034, parti... 65 9e-09 ref|XP_003557509.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 ref|XP_003609069.1| Pentatricopeptide repeat protein [Medicago t... 65 9e-09 ref|NP_001131178.1| uncharacterized protein LOC100192486 [Zea ma... 65 9e-09 gb|EAZ28899.1| hypothetical protein OsJ_12939 [Oryza sativa Japo... 65 9e-09 >ref|XP_004494504.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Cicer arietinum] Length = 641 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTVMK SEIFRR+II+RDINRFH F G CSCRDYW Sbjct: 604 CHTVMKFASEIFRREIIVRDINRFHRFTNGSCSCRDYW 641 >gb|ESW35278.1| hypothetical protein PHAVU_001G221600g [Phaseolus vulgaris] Length = 701 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTVMK SEIF+R+II+RDINRFH F G CSCRDYW Sbjct: 664 CHTVMKFASEIFQREIIVRDINRFHRFTNGSCSCRDYW 701 >ref|XP_004163774.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Cucumis sativus] Length = 556 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTVMK SEIF R+II+RDINRFH F G+CSC DYW Sbjct: 519 CHTVMKFASEIFAREIIVRDINRFHHFTNGICSCGDYW 556 >ref|XP_002276220.2| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Vitis vinifera] Length = 585 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTVMKL S+IF R+II+RDINRFH FA G CSC DYW Sbjct: 548 CHTVMKLASKIFDREIIVRDINRFHRFADGFCSCGDYW 585 >emb|CAN76247.1| hypothetical protein VITISV_023383 [Vitis vinifera] Length = 820 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTVMKL S+IF R+II+RDINRFH FA G CSC DYW Sbjct: 783 CHTVMKLASKIFDREIIVRDINRFHRFADGFCSCGDYW 820 >gb|EOY11777.1| Tetratricopeptide repeat superfamily protein [Theobroma cacao] Length = 708 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CH VMK SE+F+R+IILRDINRFH F G+CSC DYW Sbjct: 671 CHMVMKFASEVFKREIILRDINRFHHFRNGLCSCSDYW 708 >ref|XP_003617808.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355519143|gb|AET00767.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 811 Score = 67.4 bits (163), Expect = 2e-09 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTVMKL+S++ +R+I++RDINRFH F GVCSC DYW Sbjct: 774 CHTVMKLISKVVQREIVIRDINRFHHFRHGVCSCGDYW 811 >gb|EMT10341.1| hypothetical protein F775_06242 [Aegilops tauschii] Length = 610 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTVMKL+SEIF+RKII+RD RFH F GG CSC ++W Sbjct: 573 CHTVMKLISEIFQRKIIVRDATRFHHFEGGKCSCGEFW 610 >ref|NP_196272.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170345|sp|Q9FG16.1|PP367_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g06540 gi|10178110|dbj|BAB11403.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332003649|gb|AED91032.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 622 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTV KL+SE++ R++I+RD NRFH F GVCSCRDYW Sbjct: 585 CHTVTKLISEVYGRELIVRDRNRFHHFRNGVCSCRDYW 622 >ref|XP_004231338.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 625 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHT +KLVS+I+ R+II+RD+NRFH F G CSCRDYW Sbjct: 588 CHTAIKLVSKIYEREIIVRDVNRFHHFKDGSCSCRDYW 625 >ref|XP_003568436.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Brachypodium distachyon] Length = 610 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTVMK +SEIF+RKII+RD +RFH F GG CSC ++W Sbjct: 573 CHTVMKFISEIFQRKIIVRDASRFHHFEGGKCSCSEFW 610 >ref|XP_004495951.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Cicer arietinum] Length = 571 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CH VMK+VS F+R+II+RD NRFH F GVCSC+DYW Sbjct: 534 CHVVMKMVSREFKREIIVRDCNRFHHFKNGVCSCKDYW 571 >ref|XP_004955182.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Setaria italica] Length = 548 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CH MKL+SEI RR+I++RD NRFH F G+CSCRDYW Sbjct: 511 CHAAMKLISEITRREIVVRDRNRFHCFKNGICSCRDYW 548 >gb|EMS64050.1| hypothetical protein TRIUR3_15300 [Triticum urartu] Length = 414 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CH VMKL+SEIF+RKII+RD RFH F GG CSC ++W Sbjct: 377 CHVVMKLISEIFQRKIIVRDATRFHHFEGGKCSCGEFW 414 >ref|XP_004141894.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cucumis sativus] gi|449513125|ref|XP_004164238.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cucumis sativus] Length = 645 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTVMK++SEI RKI++RD NRFH F G+CSC DYW Sbjct: 608 CHTVMKMISEITGRKIVMRDRNRFHHFEDGLCSCGDYW 645 >tpg|DAA57875.1| TPA: hypothetical protein ZEAMMB73_657034, partial [Zea mays] Length = 1822 Score = 65.1 bits (157), Expect = 9e-09 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CH +KLVS++F R+I++RD NRFH F GG CSCRDYW Sbjct: 1785 CHRYIKLVSKVFNREIVMRDRNRFHHFKGGECSCRDYW 1822 >ref|XP_003557509.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like [Brachypodium distachyon] Length = 615 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CH++ KLVS +F R+IILRD+NRFH F GVCSC DYW Sbjct: 578 CHSMAKLVSMVFNRRIILRDLNRFHHFEDGVCSCGDYW 615 >ref|XP_003609069.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355510124|gb|AES91266.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 611 Score = 65.1 bits (157), Expect = 9e-09 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CHTVMKL+S++++ +II+RD +RFH F GG CSCRDYW Sbjct: 574 CHTVMKLISKVYQVEIIVRDRSRFHSFKGGFCSCRDYW 611 >ref|NP_001131178.1| uncharacterized protein LOC100192486 [Zea mays] gi|194690792|gb|ACF79480.1| unknown [Zea mays] Length = 617 Score = 65.1 bits (157), Expect = 9e-09 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CH +KLVS++F R+I++RD NRFH F GG CSCRDYW Sbjct: 580 CHRYIKLVSKVFNREIVMRDRNRFHHFKGGECSCRDYW 617 >gb|EAZ28899.1| hypothetical protein OsJ_12939 [Oryza sativa Japonica Group] Length = 611 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 1 CHTVMKLVSEIFRRKIILRDINRFHEFAGGVCSCRDYW 114 CH++ KLVS +F R+IILRD+NRFH F GVCSC DYW Sbjct: 574 CHSMAKLVSMVFNRRIILRDLNRFHHFEDGVCSCGDYW 611